KEGG   Uncinocarpus reesii: UREG_00794Help
Entry
UREG_00794        CDS       T01132                                 

Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ure  Uncinocarpus reesii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ure04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ure04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ure04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 794 aa AA seqDB search
MPPSASHISSQLRQLVYYHLDNNLIRNALFVAGRLHAFEPRSSESAYLLALCHLLAGQHV
WTLGSTWKESPLWSGVGHIGYPETIGVRDTSLVLNIYEEVITVFGVLIDSGTDKHSESRR
QHLPDAAAVLCLQGRLWKAHKDIHKAVDCYVEALKLNPFLWDAFLGLCEAGANVRVPNIY
KMTPEMIAVLTASPSAESLSSFVQGTAQVGPLQTQPNSNNVDPFVSLNPRAEGVSGSGCS
ALWEKLNGNSLNVNSGGSLATEGMETPIAQSDSDDFRVNGSGGIGSGSFGEPPLAPARKQ
RSMQVLGHEYNLDPPPKMKTTITRSKTRSRTEAEEGVSTREAPVPLVADRKRTVSGHIAP
SSSSQQTEPGAPQRRSVRLFNQIRPSSAKVSALAGSKESREIKKVKSTGVKSRNVSGSSM
TRAVSGSRKAVTEPMDIDKKETAGSQHKSAQPDRSKEIEALGWTLELFSKFASGFNALSN
YRCQEAIQIFNSLPQSQRETPWVLSHLGRAYYEQAQYSEAEKFFVRVRTIAPYNLKDMEV
YSTVLWHLKNAVELAYLAHELMEIDRLSPQAWCAIGNSFSLEGDHDQALKCFQRATQVEP
RFAYAFTLQGHEYLSNEEHDKAMDAYRHAIGADSRHYNAWYGLGKVYEKMGKFKFAEQHY
RTASSINPTNVVLICCIGLVLERMGNHRGALVQYARGCSLSPQAVVPRLRKARTLLKLQE
LKQAHSELKILKDIAPDEPNVHYLLGKFYKMMHDKGNAIRHFTTALNLDPKAAQFIKDAM
ESLENPDDFDDDIA
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgtcagcctcccatatatccagccaactgcggcaattggtctactatcacctc
gacaacaacctaatccgaaatgcccttttcgttgcgggtcgcctacatgcgttcgagccg
agatcttcagaatctgcctacttgctggccctttgtcaccttttagctgggcagcatgtc
tggaccttgggaagtacatggaaggaatcaccgctttggagcggagtaggccacattgga
tatccagaaacaattggagtgcgtgatacctctctggttttgaatatatacgaagaggtc
atcactgtttttggagtgctaattgactctggaacagacaaacatagtgaaagccgtcgc
cagcatctacctgatgccgcagccgttctatgcctccagggacgattatggaaagctcac
aaggatatacataaagctgtggactgctatgttgaagcgctgaaattgaatccctttctt
tgggatgcgtttctaggcctttgcgaagcaggagctaacgttcgagtcccaaacatctac
aaaatgacaccggagatgatagcggttctgacagcatccccttccgcagagagcctttcc
tccttcgtccaaggaacggcacaagtcggtccgctgcagacacaaccaaattccaataac
gtggaccctttcgtgtctctcaatccccgtgctgaaggagtcagtggatcaggttgttcc
gcgctttgggaaaagctgaatgggaattctttgaatgtaaattcgggcggctccttagct
accgaaggcatggaaacgcctatcgcgcaaagtgattccgatgactttcgagtgaatggg
agcggtggcatcggatcagggtctttcggagaaccaccactcgctccagcccgaaaacag
cgatccatgcaggttttgggtcacgaatacaaccttgatccacccccaaagatgaaaact
acgattaccagatcgaagacccgctcccgaactgaagctgaggaaggggtttcgactcgt
gaagcccccgtaccgctcgttgctgaccgtaagaggactgtgtcgggccacattgcacct
agttcctcctctcagcaaaccgagcctggagctccgcagaggcgaagtgtccggcttttc
aatcaaattcgtccgtcttcagctaaagtttctgctttagcaggatcgaaagagagccgc
gagatcaaaaaggtcaaatccacgggcgtgaagtctcgaaatgtctctggttcgagtatg
acgagggccgtgagcggcagccgaaaagcggtcacagaaccaatggacattgataaaaag
gagaccgccggtagtcaacataagagtgcacagcccgataggtcgaaagagatagaggct
cttggctggacccttgaactcttctccaaatttgctagtggtttcaatgcgttatccaat
tatcgatgtcaagaggctattcaaatcttcaattcattgccgcaaagtcagagagaaact
ccatgggttttatcacatcttggccgtgcgtattacgagcaagcgcaatacagcgaggcg
gaaaaattctttgttcgagtgcggacaatcgcaccatacaatctgaaggatatggaggtc
tattcaacagtcctctggcatctgaaaaatgcggttgaactggcatatctagcacacgag
cttatggaaattgatcgcctgtccccccaggcttggtgtgctatagggaattcattttcc
cttgaaggagaccatgatcaggcattaaaatgttttcaacgggcaactcaagtggaaccc
aggtttgcatacgcattcactctacaaggccatgaatatctttcaaatgaagagcatgat
aaagccatggatgcctaccgacatgcgattggtgctgatagccggcattacaatgcgtgg
tacgggctgggtaaggtatatgaaaaaatgggtaaatttaaatttgcggagcagcattac
cggacagcgtccagtatcaatccaaccaacgtggtgttgatatgctgcattggcttggtt
ttggaacggatggggaatcataggggcgcattagtacagtatgctcgaggttgctcattg
tcgccgcaagcagtcgttccgcgtttgcgcaaggctcgcacccttttgaaacttcaagag
ctcaagcaagctcactctgagctcaaaattttgaaagatattgcaccagatgaaccgaat
gtgcattatctgcttgggaagttttataaaatgatgcacgacaaggggaatgccatcagg
catttcacgactgcattgaatttggatccaaaggctgcccagttcatcaaagacgcaatg
gaatcccttgaaaaccctgacgattttgacgacgatatagcctag

DBGET integrated database retrieval system