KEGG   Uncinocarpus reesii: UREG_00794Help
Entry
UREG_00794        CDS       T01132                                 

Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ure  Uncinocarpus reesii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    UREG_00794
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    UREG_00794
   04113 Meiosis - yeast
    UREG_00794
Protein phosphatases and associated proteins [BR:ure01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UREG_00794
Ubiquitin system [BR:ure04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     UREG_00794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 794 aa AA seqDB search
MPPSASHISSQLRQLVYYHLDNNLIRNALFVAGRLHAFEPRSSESAYLLALCHLLAGQHV
WTLGSTWKESPLWSGVGHIGYPETIGVRDTSLVLNIYEEVITVFGVLIDSGTDKHSESRR
QHLPDAAAVLCLQGRLWKAHKDIHKAVDCYVEALKLNPFLWDAFLGLCEAGANVRVPNIY
KMTPEMIAVLTASPSAESLSSFVQGTAQVGPLQTQPNSNNVDPFVSLNPRAEGVSGSGCS
ALWEKLNGNSLNVNSGGSLATEGMETPIAQSDSDDFRVNGSGGIGSGSFGEPPLAPARKQ
RSMQVLGHEYNLDPPPKMKTTITRSKTRSRTEAEEGVSTREAPVPLVADRKRTVSGHIAP
SSSSQQTEPGAPQRRSVRLFNQIRPSSAKVSALAGSKESREIKKVKSTGVKSRNVSGSSM
TRAVSGSRKAVTEPMDIDKKETAGSQHKSAQPDRSKEIEALGWTLELFSKFASGFNALSN
YRCQEAIQIFNSLPQSQRETPWVLSHLGRAYYEQAQYSEAEKFFVRVRTIAPYNLKDMEV
YSTVLWHLKNAVELAYLAHELMEIDRLSPQAWCAIGNSFSLEGDHDQALKCFQRATQVEP
RFAYAFTLQGHEYLSNEEHDKAMDAYRHAIGADSRHYNAWYGLGKVYEKMGKFKFAEQHY
RTASSINPTNVVLICCIGLVLERMGNHRGALVQYARGCSLSPQAVVPRLRKARTLLKLQE
LKQAHSELKILKDIAPDEPNVHYLLGKFYKMMHDKGNAIRHFTTALNLDPKAAQFIKDAM
ESLENPDDFDDDIA
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgtcagcctcccatatatccagccaactgcggcaattggtctactatcacctc
gacaacaacctaatccgaaatgcccttttcgttgcgggtcgcctacatgcgttcgagccg
agatcttcagaatctgcctacttgctggccctttgtcaccttttagctgggcagcatgtc
tggaccttgggaagtacatggaaggaatcaccgctttggagcggagtaggccacattgga
tatccagaaacaattggagtgcgtgatacctctctggttttgaatatatacgaagaggtc
atcactgtttttggagtgctaattgactctggaacagacaaacatagtgaaagccgtcgc
cagcatctacctgatgccgcagccgttctatgcctccagggacgattatggaaagctcac
aaggatatacataaagctgtggactgctatgttgaagcgctgaaattgaatccctttctt
tgggatgcgtttctaggcctttgcgaagcaggagctaacgttcgagtcccaaacatctac
aaaatgacaccggagatgatagcggttctgacagcatccccttccgcagagagcctttcc
tccttcgtccaaggaacggcacaagtcggtccgctgcagacacaaccaaattccaataac
gtggaccctttcgtgtctctcaatccccgtgctgaaggagtcagtggatcaggttgttcc
gcgctttgggaaaagctgaatgggaattctttgaatgtaaattcgggcggctccttagct
accgaaggcatggaaacgcctatcgcgcaaagtgattccgatgactttcgagtgaatggg
agcggtggcatcggatcagggtctttcggagaaccaccactcgctccagcccgaaaacag
cgatccatgcaggttttgggtcacgaatacaaccttgatccacccccaaagatgaaaact
acgattaccagatcgaagacccgctcccgaactgaagctgaggaaggggtttcgactcgt
gaagcccccgtaccgctcgttgctgaccgtaagaggactgtgtcgggccacattgcacct
agttcctcctctcagcaaaccgagcctggagctccgcagaggcgaagtgtccggcttttc
aatcaaattcgtccgtcttcagctaaagtttctgctttagcaggatcgaaagagagccgc
gagatcaaaaaggtcaaatccacgggcgtgaagtctcgaaatgtctctggttcgagtatg
acgagggccgtgagcggcagccgaaaagcggtcacagaaccaatggacattgataaaaag
gagaccgccggtagtcaacataagagtgcacagcccgataggtcgaaagagatagaggct
cttggctggacccttgaactcttctccaaatttgctagtggtttcaatgcgttatccaat
tatcgatgtcaagaggctattcaaatcttcaattcattgccgcaaagtcagagagaaact
ccatgggttttatcacatcttggccgtgcgtattacgagcaagcgcaatacagcgaggcg
gaaaaattctttgttcgagtgcggacaatcgcaccatacaatctgaaggatatggaggtc
tattcaacagtcctctggcatctgaaaaatgcggttgaactggcatatctagcacacgag
cttatggaaattgatcgcctgtccccccaggcttggtgtgctatagggaattcattttcc
cttgaaggagaccatgatcaggcattaaaatgttttcaacgggcaactcaagtggaaccc
aggtttgcatacgcattcactctacaaggccatgaatatctttcaaatgaagagcatgat
aaagccatggatgcctaccgacatgcgattggtgctgatagccggcattacaatgcgtgg
tacgggctgggtaaggtatatgaaaaaatgggtaaatttaaatttgcggagcagcattac
cggacagcgtccagtatcaatccaaccaacgtggtgttgatatgctgcattggcttggtt
ttggaacggatggggaatcataggggcgcattagtacagtatgctcgaggttgctcattg
tcgccgcaagcagtcgttccgcgtttgcgcaaggctcgcacccttttgaaacttcaagag
ctcaagcaagctcactctgagctcaaaattttgaaagatattgcaccagatgaaccgaat
gtgcattatctgcttgggaagttttataaaatgatgcacgacaaggggaatgccatcagg
catttcacgactgcattgaatttggatccaaaggctgcccagttcatcaaagacgcaatg
gaatcccttgaaaaccctgacgattttgacgacgatatagcctag

DBGET integrated database retrieval system