KEGG   Uncinocarpus reesii: UREG_00803Help
Entry
UREG_00803        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ure  Uncinocarpus reesii
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ure00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 664 aa AA seqDB search
MAPTPPSKQKERLTLAQLAAYDDILTDTLVDRAFFWTKIRKNRPKYFPVRGIVEEDVTSI
LLHDVIVAKDLAKAEKELLSLSGLKKYVEKLRSEKEREWFRRHLRKYIAIYLPDCPFEVT
TTNRYTITTHEAALSARKYIRTGDTIRHLSGTLVAITAEEEMNLDLTRRDFSIVMSSRRK
TPSLFLGPARFSNHDCNPNARLVTKGSEGMEIVAIRDIAINEEITVSYGDNYFGIDNCEC
LCHTCELDLRNGWAPDGPAEHDSRASTPEPSTEEEQTKAPQSTAKRECPSEPAAQPFPDT
PAKKPRLEMRPSNLRLELSPPSSPDPIAEPLITISGGLRGLRSHFAAVISKPELPHYPSS
NSNVTSVSSCSNDTPNSTRSTSATSLSDSTVQVNADPTVASKCEAPAANIRPNGLPDQRL
RIDTIIRDNDESDLSDLSASWEINDNEMTVVKRGSIKKTRKRKSHIIPTIEHEPPKVRTA
GDYTKTPKLLAQRYDRWVDCQTCNAWFVQGDAYLTRKECPRCERHSKLYGYRWPKTDKEG
RNDTEERVMDHRTIHRFLTTEDESRVLRRGRGVSNATSPTRDVSENRTETDAISSPDKHM
VNRVIIDNLAKLIHIHNLIPQRLHLRHHLPPPSLLAHLVQKVPVVPGRVRPKGALGIVHA
HPGL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcacctactccgccgtcgaagcagaaagaacggttgaccctcgctcagcttgcagcc
tacgatgacattctgacggacacgttggtcgatcgcgcgttcttctggaccaagatccgt
aaaaatcgacccaaatatttcccggttcgaggcattgtagaggaagatgtcacatcgata
ctactccacgatgttattgttgccaaagacctggcaaaggcggaaaaagaactgcttagc
ctttcaggactcaagaaatatgttgagaagctcagatctgagaaggaaagggagtggttt
cgccgccatttgcgaaaatatatcgccatctacttgccagattgtcctttcgaagttact
actacaaatcgctatactattaccactcatgaggcagcactttcagcgagaaaatatatt
cgcaccggcgataccatcaggcacctttccggaacccttgtcgcgataactgctgaagag
gagatgaacctcgatctcacaagaagggatttcagcattgtaatgtccagcaggaggaaa
accccgtcactatttctcgggcctgcaagattttcgaatcacgactgcaatcccaatgca
agattggttacaaaaggctcagaaggcatggagattgtggcgatcagggacattgccatc
aatgaagaaatcacggtgtcatacggagacaattattttggtatagacaactgcgaatgc
ctctgccatacctgtgagctggatctgcgcaacgggtgggctcccgatgggccggcggaa
catgacagtcgcgcctccacgccagagccttcgactgaggaagaacagacaaaggcaccc
cagtctactgccaaaagagagtgcccctccgagcccgctgcacagccgtttcctgatacg
cccgcgaaaaagcccaggctagaaatgaggccgtcaaatctgcgactggaattatcgcca
ccaagcagtcccgaccccattgctgaacctctgatcacaatcagtggtggcttgcgcggg
ctacgaagccacttcgcggccgttatcagcaagccagaactgccacactatccatcatcc
aactcaaacgtcacctcggtttcatcttgcagcaatgacactcctaactctacaagatca
acttcggccacatcgctctctgattctactgttcaggtaaacgctgatcctacggtggca
tcaaaatgcgaagcgcctgctgcaaacattcggccaaatggcctcccggatcaaagactc
cgcattgacaccatcatccgagataacgatgaatcagatttgtcagacctgtctgcatcg
tgggagatcaatgataatgaaatgacagtggtgaaacgggggtcgattaagaaaactaga
aaacgcaaaagccacatcattcccacaatcgaacatgagccaccaaaggttcgaacggct
ggcgattataccaaaactcccaaactactcgcgcagcggtatgatcgctgggtagactgc
cagacctgcaatgcgtggtttgttcagggcgatgcatacctcacgcgaaaggagtgcccg
cgatgcgagcggcactcaaagctgtacggttatcgctggcctaagaccgataaagaaggc
cggaatgacaccgaggagcgtgtcatggatcatcgcaccattcatcggttcttgacaaca
gaggacgaatcccgtgttctgcgacgaggtcgtggtgttagcaacgccacgagtcctacg
cgcgatgtttctgaaaacaggacggagacggatgccatctcgtcaccagacaagcacatg
gttaaccgggtcataatagacaatctcgccaaactcattcacatccacaacctcataccc
cagcgcctgcatctccgccaccacctgcctccgccgtctctcctcgcgcacctcgtccag
aaagtgccggtcgtacctgggcgtgtgcggccaaaaggtgccctcgggatagttcatgcg
caccctggcctctga

DBGET integrated database retrieval system