KEGG   Uncinocarpus reesii: UREG_00905Help
Entry
UREG_00905        CDS       T01132                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ure  Uncinocarpus reesii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UREG_00905
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UREG_00905
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     UREG_00905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVGADYLFLMTDVDGLYTSNPRTNPDAQ
VIEVVEDISSLDVDVSTAGSSLGTGGMSTKIVAARLASSAGVTTVITRSSLPDYGSLLRH
LEQKQVFSPRALWQSKGHFSQQEAVRLVVVERRSPSALNGDFQHHGEEPKEVGRALVNYG
SAEIARIKGSRSTQIQAILGYADSEYVALRENIFFFHMMDRPSRPGTPGLDEMMVRSGAQ
SPAIEKLLAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgatccccattgtaaacgagaacgatacgcttgctgtttcggaaatcaaattt
ggcgacaacgatactctttcggctattaccgccgctatggtcggggctgattatctgttc
ctgatgactgatgtcgatgggctatatacgtccaacccacgaactaaccctgatgcccag
gttattgaagttgtggaggacatctcctctcttgacgtggacgtgtcaacagctggttct
tcactgggcacgggaggcatgagtactaaaattgtggcagcccgattggcatcaagcgca
ggcgtcaccacagtcatcactcgcagctccctccccgactacgggagcctactgcgccat
cttgaacaaaagcaagtcttctccccgcgggcgttgtggcaatcgaaaggacacttctcc
caacaagaagcggtacgactggtagttgtcgaacgccgctctccgtccgccctcaacgga
gatttccagcatcatggcgaagaaccaaaggaagtcggacgagcgcttgtgaactatggc
agcgcggaaatcgcccggataaaggggtcgcggagtacgcagatacaggcgattttgggc
tatgcggacagcgaatatgtcgccttgcgtgagaacattttttttttccacatgatggat
cgaccaagccgacctggcacgccgggcttggatgaaatgatggttcgaagcggtgcgcag
tccccggcgattgagaagcttctggctatctaa

DBGET integrated database retrieval system