KEGG   Uncinocarpus reesii: UREG_01049Help
Entry
UREG_01049        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ure  Uncinocarpus reesii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ure00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 471 aa AA seqDB search
MRPRCSPARALEELRTFAHAKRRPHARPCLPLPTPLTHPWRLHFSSTARNEGRNIAVIGG
GITGLTTAHHLAKDPTINVTVWERSDRLGGHLNSEKIDVGDGHIVFDYGPRTFQANAKAF
STLDLIIDLGLSEQIILTSIHDAASRNRYIYYPDHLVRLPGPQPGGGLLVNIISNVISLF
TEPLLKGLPWAIAAESFKPKRSAKLEDESIGDFMTRRLGSAITDNIVSAVLHGIYGGDIY
KLSAKTILPAWWQLELKGRGGVFLPLLSPKRNVRVAYDIYRELQLLSEEKGVTYPRELLS
RVSGASVFALKAGMGQLVDGLTRSLSASPNVKIQTGLGIKELKLNDSRWQVKASDNRQIT
YDEIVSTTSPHELHRQLAPTLRRTDAFRDLQGHNYAVSVMIVNLFFKSPNLVPVNGFGYL
IPQSVALEQNPERALGVVFMSCCNVEQDTAQGTKLTVMLGGHCIPWDTLPA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgcgatgctcgcccgcccgtgcacttgaagagcttcggacatttgcccatgcg
aagcgccggcctcacgccagaccatgcctcccgcttccaacgccattgacacacccatgg
cggttgcacttttcctccaccgcccgaaatgaaggtagaaatatcgcggtgatcggcggc
gggattacgggtctcacgacggctcaccatctcgccaaagacccgacaatcaatgtcacg
gtctgggagcggtcggatcggttaggcggacaccttaattctgaaaagattgatgtggga
gatgggcatattgttttcgattacgggcctcgcacctttcaagcgaatgcgaaggccttc
tctacgcttgacttgataatagaccttggtctttcggagcagataattcttactagcatt
cacgatgcagcttcgcggaaccgctacatatactaccctgaccatcttgttcgcctgcct
ggcccacaaccgggaggaggcctgctcgtgaacatcatttccaacgttataagtctcttt
acagaaccgctgctgaagggtctaccttgggcgattgcggctgagtcgttcaaacccaaa
aggagcgcaaaacttgaagatgaatctattggcgattttatgaccaggaggctagggagc
gctattacggacaatattgtctctgcagtcctccatggtatctatggaggtgacatttat
aaacttagcgcgaaaacaatactcccagcttggtggcaactggagctgaaaggcagaggg
ggcgtttttctaccgttgttatcccctaagaggaatgtacgtgtcgcatatgacatttac
cgtgaacttcaactactcagcgaggaaaagggtgtgacctacccgcgcgagctcctatct
cgcgtgagcggtgctagtgtatttgccttgaaagcgggaatgggtcagctggttgatggg
ttgaccaggtcgctttccgcttcacctaatgtgaagatacagactggcttggggattaaa
gagctaaagctcaacgattctcgatggcaggttaaagcgagcgacaatcggcaaattacc
tatgatgagatcgtttccacaacgtctccccatgagctacatcggcagctagctcccacg
ctcagacgcacagatgccttcagagaccttcaaggccataactatgccgttagtgtcatg
atcgtcaatcttttcttcaaatctccgaatttagttcccgtcaatgggtttggctatctg
atccctcagtctgtagccctggaacagaacccagaacgcgccttgggagtcgtattcatg
tcctgttgcaacgtggagcaagacacggcacaaggcaccaagttaaccgttatgctggga
ggtcactgtataccgtgggacacacttcccgcatga

DBGET integrated database retrieval system