KEGG   Uncinocarpus reesii: UREG_01158Help
Entry
UREG_01158        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ure04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1115 aa AA seqDB search
MRGPVAGSHANSAHYSDRASIGADAAYRQYLDMDSLQEMAASLNLKGDVPLNELVRISED
AIQKSKILAQQGQLDLALVQYLRASDVVINTIPRHPDFAYMKQHHPRWADQFSGLMMAVN
SQHSTMENIKKKITLENTNGYGAGDNQSRPSSRGYLVTTNSPSDSSSRYEGVQSPTDLPI
RMPSPSSFQYTSGTGVPSILQPTGSPSKKPKPEVKPKPENLTRRLARDKVPAEDSLAQRF
AELRNPGRASAVCDNNGMILDSTFFPSPSAEASHPSSVPDPRLALNTRPPRPLGPREMNT
PYGEPPALPPKLPISPVNHSLPTFPTPAYSPNTTIPSQPPHNPPRTSIDSLRPGPYKQSF
PWMGDLNDGFNAADDNPYRSRTPTEMHAEGDVRSKMADTTVGASISAERLLEYLRKHDVL
LIDVRSRDQYDTGHINAKSVICIEPVVLKENVSAEELEDRLIISPEAEQSLFSRRNEFDL
IVYYDQNTTDPSYLRGSPASSSLPHLRALYDTLYEFNMYKPLKYGRQPVLLVGGLDAWVD
LVGPQSLATTHTAAIMHSVRARKPIPGKYQPLRRMPTVSANSSWEVKKRRLREFKPLDAE
EERAWLEKAKVEEIDPASYYAGDGVISEEPEDLEPTESESTSPFFHTYEDFLRRFPEPHD
NQQSMAGLPTNEPPSIGLYESTIPPPSRPAPAVPRPSYSGVTDDRHIQPPLARQASATKH
ALYKSSSPLDRVKLPRTGLVNLGSTCYMNSIIQSLSATTELTKFFFDNRFHAQVQKNWKG
SQGVLPGLYANLVRSLWKNDVEVIRPTSFRKFIGRLNSEWAGSQQQDAKEFFDVLVDCLH
EDLNVNWQRTPLRPLTTEQEMRRERTPVHQVSGIEWSRYCHRELSYISTLFAGQHASRLR
CTTCRRTSTTYEAFYSISVEIPVSGTGDIYQCLRSYCQEEMLSGDEVWKCPHCRTEREAT
KQIILTRAPRFLVLHFKRFSASHRQQARKIHTPVYFPLSGLDLSPFMIEPSNYPPTPQQN
GNPTHSDTSTQAELTPHELATSPPYIYNAYAVVRHLGSTIHEGHYISMARDANRDCWRKF
DDHRVTDFTPGGPRSPDCLQNEQAYLVFYERVPAN
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgcggggacccgtcgccggaagtcatgccaacagcgcacattacagtgaccgagctagt
atcggtgccgatgcagcatacaggcaatatttggatatggactcgttgcaggaaatggct
gcgtcgttaaacctgaaaggcgacgttccactgaatgaactggttcgaatatccgaagat
gccattcagaagtctaagatcttagcgcagcaagggcaactagatcttgcgcttgtgcag
taccttcgagcgtctgacgtggtgattaacacaattccgaggcacccagacttcgcctac
atgaaacaacaccatccacgatgggcagatcaattttcagggcttatgatggccgtgaat
tcccagcactcgacaatggagaacatcaagaagaagattacccttgagaataccaatggt
tatggcgccggtgacaaccagtcgcggcctagttcgcgagggtatcttgtcaccacaaac
tccccgtcagattcctcgtctcgatacgaaggagtccaaagccctactgacctcccaatt
cgcatgccgagtccttcgagcttccaatatacttcgggcactggtgttccgtcaatacta
cagccaacaggctccccgtcgaaaaagccaaagccagaagtgaaacctaaaccggagaac
ctcacccgaagactcgccagagacaaagttccagcagaagattctctcgcccaacgattc
gctgaattaaggaatccaggaagggcttcagccgtgtgcgacaataatggtatgatttta
gacagcacattcttcccttctccctccgcagaggcctctcacccttcttcggttcccgat
cctcgcttggctttgaatacacgacctcctcgtcctttaggcccacgggagatgaatact
ccctatggtgaacccccggctttacctccgaaactcccaatttcaccagtcaatcattcg
cttcctacatttcctacccctgcgtacagccctaataccaccattccatctcaaccaccc
cataatcctcccagaacttcaatcgatagcctccgccctggaccctacaaacaatctttt
ccatggatgggtgatttgaacgatggtttcaatgccgccgatgataatccgtaccgttcg
cgcacccctaccgagatgcatgctgaaggcgatgtaaggagcaaaatggcagacacgact
gtcggagcatcgatttctgccgaacgcttactggagtaccttcgcaaacacgatgttctg
cttatcgatgttcgttcccgagatcagtacgacactggtcacataaatgcaaaatccgta
atatgcattgagccagtcgtgctgaaggaaaatgtctctgcggaagaactagaagaccgc
ttaattatatcgcccgaagctgagcaatctttgttctcgagacgaaacgaatttgacctc
atcgtgtattacgaccaaaataccaccgatccatcctatcttcgtggatccccggcctcc
agtagccttcctcacctgagagctctgtacgacacactctacgagttcaatatgtataag
cccctgaaatatggccggcaaccggttttacttgttggcgggcttgatgcctgggtagac
ttagtcgggccgcagtcattagcaactacccacaccgctgctataatgcattcagttcgg
gcacgcaagcctatcccagggaaataccagccgctgaggagaatgccaactgtcagcgct
aattcaagttgggaagtaaagaagaggagactgcgtgaattcaagccccttgacgcggaa
gaggagcgagcgtggttagaaaaggcgaaagttgaagagatcgacccggccagctactac
gcgggcgatggggttatctctgaagagcccgaagacctggaaccaaccgaatcggaatca
acctctccttttttccacacatatgaagattttcttcggcgcttccctgagccccatgat
aaccaacaatctatggccggtctgccaacaaacgagcctccatcaattggtctttatgag
tccacgatcccacccccttcccggccagcaccggcggtccctcgcccatcatatagtgga
gtcaccgacgaccgacacatacaacctcctctcgcgcgacaggcctctgccaccaagcac
gcgttgtacaaatccagctctccccttgatcgggtcaagctccctcgcactggccttgtc
aatctgggatcaacgtgctatatgaattcaattatccaaagtttaagcgcaacaacagag
ctcaccaaatttttctttgataaccgctttcatgctcaggttcaaaagaactggaaaggt
tcccaaggcgttctgccagggctttacgcgaaccttgttcggtctttgtggaaaaatgac
gttgaagtcatccggcctacgtcttttcgaaaatttatcggacgactgaactctgaatgg
gcaggtagccagcagcaggatgctaaagagttttttgatgtccttgtcgactgcttgcac
gaagatctcaatgtaaactggcaaaggactcctctacgcccattgacaacggaacaagag
atgcgccgtgagcggacgccagtccaccaagtttcagggatagagtggagtcgatactgc
catcgagaactatcgtacatttctactctttttgctgggcaacacgccagccgattacgt
tgtacgacatgtcggcgtacatccacgacttacgaggctttttatagcatcagcgtggag
atccccgtgtctggcaccggggatatataccaatgtctccgcagttattgccaagaggag
atgctcagcggtgatgaggtttggaaatgccctcattgtcgaactgagagagaggctact
aaacaaattatcctaactcgcgccccgcggtttctcgtcctccacttcaaaagattctct
gcttcccatcgccaacaagcccgaaaaatccatacacctgtctactttcctctctctggc
ttagatctcagtcctttcatgattgaaccttctaattaccctcctacaccacaacaaaat
gggaatcccactcactcggatacgtcaacacaggctgagcttacgccgcatgagctggca
acatctcctccgtatatctacaatgcctatgcagttgtgcggcacttgggatcaaccatc
catgaaggccattatatttcaatggctcgtgacgccaatcgtgattgttggcgcaagttt
gacgaccatcgagtcacggatttcacgcccggtggccctcgatcacccgattgtctccaa
aacgaacaagcatatttggtgttttatgagcgggttccagcgaactaa

DBGET integrated database retrieval system