KEGG   Uncinocarpus reesii: UREG_01249Help
Entry
UREG_01249        CDS       T01132                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ure  Uncinocarpus reesii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    UREG_01249
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     UREG_01249
Transfer RNA biogenesis [BR:ure03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    UREG_01249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MSYQKELLVAQLAVQRASILTQNVFHEKAKGTLSKDDFSPVTKGDFGAQALIIQAIRTNF
PEDEIVAEEEASSLRENDSLRNEMWNLVKDIKLTDDESDRILGGPLKNETEMLEALDGGK
SEGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLIVDGDVKVGVIGCPNLPLSDSATLSAE
IGQSGAADAETGVLFSAVKGQGATSRPLSQGALPEGKAISMRPVTDISQACFCEGVEAGH
SAQDDNAEVARRLGITSPSVRLDSQAKYCSIARGAGDIYLRLPVKADYQEKIWDHAAGDL
LVREAGGDVTDITGKRLDFSIGRKLSGNKGVVAAPKPIFEQVINAVRAVYAAKASI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaaaaggaattgctggtggcccagttggcggttcagagagcttccatcttg
acccaaaacgtgtttcacgagaaggccaaaggcaccttgtccaaggacgatttctccccc
gtaacgaaaggggactttggcgcccaggccttgatcattcaagcaatccgcacaaacttc
cctgaagatgaaattgtggcagaggaagaggcgagttcccttcgcgagaacgattcgttg
agaaacgagatgtggaatcttgtcaaggatatcaagctcaccgacgacgaaagcgaccga
attctcggcgggcccttgaagaatgagaccgaaatgcttgaagctctcgacggcggaaag
agcgagggtggccccaagggcagaatatgggccttggaccccatcgacggcacaaagggt
ttcctccgtggtggacagtatgcggtctgccttggcctcattgtagacggtgatgtcaag
gtcggcgtgattggatgcccaaaccttcctctttctgattctgcaacgctctctgcagaa
attggccagtctggtgccgcagatgcagagaccggtgttctcttctctgctgtcaaggga
cagggagccaccagccgtccactttcccagggcgctttgccagagggcaaagcgatttcc
atgaggccagtcacggatatctcccaggcctgcttctgcgagggcgttgaggccggtcac
tccgcccaggacgataacgccgaagtcgccagacgccttggaatcacctcacccagcgtg
cgcctggattcgcaagccaagtactgctcaattgctcgcggtgccggcgatatttacctc
agattaccagtcaaggccgattaccaggagaagatttgggaccacgccgcaggagatttg
cttgtacgcgaagctggaggcgatgtcactgacatcactggcaagagacttgacttcagc
attggtaggaagctgtcgggcaacaagggtgtggtggcagcaccgaaacctattttcgag
caggttatcaatgcggttcgcgctgtatatgcagcaaaggcgtcgatctag

DBGET integrated database retrieval system