KEGG   Uncinocarpus reesii: UREG_01249Help
Entry
UREG_01249        CDS       T01132                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ure  Uncinocarpus reesii
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ure00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MSYQKELLVAQLAVQRASILTQNVFHEKAKGTLSKDDFSPVTKGDFGAQALIIQAIRTNF
PEDEIVAEEEASSLRENDSLRNEMWNLVKDIKLTDDESDRILGGPLKNETEMLEALDGGK
SEGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLIVDGDVKVGVIGCPNLPLSDSATLSAE
IGQSGAADAETGVLFSAVKGQGATSRPLSQGALPEGKAISMRPVTDISQACFCEGVEAGH
SAQDDNAEVARRLGITSPSVRLDSQAKYCSIARGAGDIYLRLPVKADYQEKIWDHAAGDL
LVREAGGDVTDITGKRLDFSIGRKLSGNKGVVAAPKPIFEQVINAVRAVYAAKASI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaaaaggaattgctggtggcccagttggcggttcagagagcttccatcttg
acccaaaacgtgtttcacgagaaggccaaaggcaccttgtccaaggacgatttctccccc
gtaacgaaaggggactttggcgcccaggccttgatcattcaagcaatccgcacaaacttc
cctgaagatgaaattgtggcagaggaagaggcgagttcccttcgcgagaacgattcgttg
agaaacgagatgtggaatcttgtcaaggatatcaagctcaccgacgacgaaagcgaccga
attctcggcgggcccttgaagaatgagaccgaaatgcttgaagctctcgacggcggaaag
agcgagggtggccccaagggcagaatatgggccttggaccccatcgacggcacaaagggt
ttcctccgtggtggacagtatgcggtctgccttggcctcattgtagacggtgatgtcaag
gtcggcgtgattggatgcccaaaccttcctctttctgattctgcaacgctctctgcagaa
attggccagtctggtgccgcagatgcagagaccggtgttctcttctctgctgtcaaggga
cagggagccaccagccgtccactttcccagggcgctttgccagagggcaaagcgatttcc
atgaggccagtcacggatatctcccaggcctgcttctgcgagggcgttgaggccggtcac
tccgcccaggacgataacgccgaagtcgccagacgccttggaatcacctcacccagcgtg
cgcctggattcgcaagccaagtactgctcaattgctcgcggtgccggcgatatttacctc
agattaccagtcaaggccgattaccaggagaagatttgggaccacgccgcaggagatttg
cttgtacgcgaagctggaggcgatgtcactgacatcactggcaagagacttgacttcagc
attggtaggaagctgtcgggcaacaagggtgtggtggcagcaccgaaacctattttcgag
caggttatcaatgcggttcgcgctgtatatgcagcaaaggcgtcgatctag

DBGET integrated database retrieval system