KEGG   Uncinocarpus reesii: UREG_01592Help
Entry
UREG_01592        CDS       T01132                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ure  Uncinocarpus reesii
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ure00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ure00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MATKLAAARYGKENVKVCKVHRDAKSGTHEVTELTVAVSLEGDIESSYTKADNSVVVATD
SMKNTIYLLAKQHSVTPPELFASIVGTHFIETYNHIHAAHVRVVVHRWTRMNADGKPHPH
AFLRDGTDVRVAEAYVVDGKGVKIKSSISGLLVLKSTGSQFHGFIRDEYTTLPETWDRIL
STEIDASWIWAPFVNLNHVRSAGHKFDQAFTAAREISLNIFAQDDSASVQNTMYKMASEI
LSSEPLLQSVSYSLPNKHYLELGKSTIAEHGSHDDAVCTNNSPDLSWHKGLKNTGANAEV
YIPSPAPNGLIQCTISRENNTRATNSKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagttagccgccgcacgttatggcaaggaaaatgtcaaagtgtgcaaagtt
caccgtgatgccaaatctggtacacacgaagtcacagaactgacggtcgccgtgtcgctc
gaaggcgatatcgaaagctcatataccaaagcagacaatagcgtggttgttgcgactgac
tctatgaaaaataccatctacctcctggccaaacaacattctgtcactcctcccgagctg
tttgcatccatcgttgggacccatttcatagaaacttacaaccacatccatgccgcccat
gtccgtgtcgtcgttcatcgatggactcgaatgaacgctgacggaaagccacacccgcat
gcgttcttgcgcgatggcacagatgtgcgagtcgcggaggcctacgtcgttgatggcaag
ggcgtcaagataaaatcctcaatatctggtctgctggttttgaaaagtacgggatcacag
ttccacggcttcattcgtgatgagtatacaacgcttccggaaacatgggataggatttta
agcacggaaatcgacgcaagttggatctgggccccgtttgtgaacctcaaccatgtcagg
tccgcgggtcacaagttcgatcaagcatttactgcggcgcgcgagataagtctaaacata
tttgcgcaagacgacagtgcgagtgtgcagaacacgatgtataaaatggccagtgagatc
ttgagtagcgaaccgctattgcaatctgtgtcatactcccttccaaacaagcattatctt
gaactaggcaagtccacgatcgcagaacacggttctcatgatgatgctgtttgtactaat
aactcaccagatcttagttggcacaagggtctaaagaacacaggggccaatgcggaagtt
tatatacctagtcccgctccaaatggtttgatccaatgcaccatttcacgggaaaataac
acgagagcgacgaattcgaagctataa

DBGET integrated database retrieval system