KEGG   Uncinocarpus reesii: UREG_01592Help
Entry
UREG_01592        CDS       T01132                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ure  Uncinocarpus reesii
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UREG_01592
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    UREG_01592
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     UREG_01592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MATKLAAARYGKENVKVCKVHRDAKSGTHEVTELTVAVSLEGDIESSYTKADNSVVVATD
SMKNTIYLLAKQHSVTPPELFASIVGTHFIETYNHIHAAHVRVVVHRWTRMNADGKPHPH
AFLRDGTDVRVAEAYVVDGKGVKIKSSISGLLVLKSTGSQFHGFIRDEYTTLPETWDRIL
STEIDASWIWAPFVNLNHVRSAGHKFDQAFTAAREISLNIFAQDDSASVQNTMYKMASEI
LSSEPLLQSVSYSLPNKHYLELGKSTIAEHGSHDDAVCTNNSPDLSWHKGLKNTGANAEV
YIPSPAPNGLIQCTISRENNTRATNSKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagttagccgccgcacgttatggcaaggaaaatgtcaaagtgtgcaaagtt
caccgtgatgccaaatctggtacacacgaagtcacagaactgacggtcgccgtgtcgctc
gaaggcgatatcgaaagctcatataccaaagcagacaatagcgtggttgttgcgactgac
tctatgaaaaataccatctacctcctggccaaacaacattctgtcactcctcccgagctg
tttgcatccatcgttgggacccatttcatagaaacttacaaccacatccatgccgcccat
gtccgtgtcgtcgttcatcgatggactcgaatgaacgctgacggaaagccacacccgcat
gcgttcttgcgcgatggcacagatgtgcgagtcgcggaggcctacgtcgttgatggcaag
ggcgtcaagataaaatcctcaatatctggtctgctggttttgaaaagtacgggatcacag
ttccacggcttcattcgtgatgagtatacaacgcttccggaaacatgggataggatttta
agcacggaaatcgacgcaagttggatctgggccccgtttgtgaacctcaaccatgtcagg
tccgcgggtcacaagttcgatcaagcatttactgcggcgcgcgagataagtctaaacata
tttgcgcaagacgacagtgcgagtgtgcagaacacgatgtataaaatggccagtgagatc
ttgagtagcgaaccgctattgcaatctgtgtcatactcccttccaaacaagcattatctt
gaactaggcaagtccacgatcgcagaacacggttctcatgatgatgctgtttgtactaat
aactcaccagatcttagttggcacaagggtctaaagaacacaggggccaatgcggaagtt
tatatacctagtcccgctccaaatggtttgatccaatgcaccatttcacgggaaaataac
acgagagcgacgaattcgaagctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system