KEGG   Uncinocarpus reesii: UREG_01609Help
Entry
UREG_01609        CDS       T01132                                 

Definition
phosphatidylinositol 3-kinase tor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ure  Uncinocarpus reesii
Brite
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   UREG_01609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2396 aa AA seqDB search
MSQASSVADATQKLFLELKSKNEETRHRAALELYDNVVAVSRELPQDKFLEYYNTVSGRI
AQLVVTGSDANEKIGGLLALDRLIDFDGVDAAQKTTRFSGYLRSALKSNDNTVLLYAATS
LGRLAKPGGALTAELVESEIQSALEWLQSERQENRRFAAVLVIRELAKGSPTLLYGFIAQ
ILELVWVALRDPKVLIRETSADAISQCFEIISARDSQVRHQWFAGIYDETLLGLRSTNVD
WIHGSLLALRELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRIQVAATIPVLASYAPLD
FTNTYLHRFMIYLQAQLKRDKERNAAFIAIGKIASAVGNAIGQFLDGIIVYIREGLTLKA
RNRAAVNEAPMLECLSMLALAVGQTLSKYMESLLDPIFACGLSKALTQALVDIAHYIPPI
RATIQEKLLDMLSLVLCGKPFQPLGCPDNRAPPMPSFVKDSTQPPQEATDSEITLALLTL
GSFDFSGHILNEFVRDVAIKYVDNDNAEIRKASALTCCQLFVHDPILNQTSSHSLQVVSQ
VIDKLLSVGVGDPEPEIRCTVLQSLDQKFDRHLAKPENVRCLFLAVNDEVFMVREAAISI
IGRLSNVNPAYVFPPLRKLLVNLLTGLSFATTPRQKEESAQLISLFVSNATKLVRSYVDP
MITTLLPKTTDFNPAVSATTIKAIGELATIGGDDMKQYLPQIMPIILDALQDLSSPSKRE
AALRTLGQLASNAGYVIEPYKEYPQLLAVLINIVKTEQAGSLRKETIKLIGTLGALDPYK
YQQISQDTPDVHHINEVQAVSDVSLIMQGLTPSNEEYYPTVVINTLLQNILSESSLAQYH
SAVIDAIVTVFKTLGLKCVPFLGQIIPAFISVIKNTPTSRLETYFNQLAILVTIVRQHIR
AFLPEIIVVVREYWDASYQVQATILSLVEAISKSLEGEFKKYLASLIPLMLDTIEKDNSP
RRQPSERILHTFLVFGSSAEEYMHRIIPAIVRSFDKPQAPQSIRKSAIETLAKLSRQVNV
SDFASLMIHPLARVIGGSDRTLRQSALDCICTLIFQLGQDFTNYIQLINKVLHLLPPLSD
FFTNFWQVLKNNQIHHHNYQILISKLQKGEPLPQDLNPDEQYGSFGDDQSFGEVGQKKIL
VNQQHLKNAWDATQKSTREDWQEWMRRFSVELLKESPSHALRACASLAGIYQPLAKDLFN
AAFVSCWTELYHTYQEELVHSIDLALRARNIPPEILQILLNLAEFMEHDDKALPIDIRTL
GKYAGKCHAFAKALHYKELEFEQDQNSSAVEALISINNQLQQFDAAIGILRKAQAYRDVE
LKETWFVKLQRWEEALAAYKRRELIDPDSFEVTMGKMRCLHALGEWKMLSDLAQEKWNQA
SNDHRISIAPLAAAAAWGRGQWGLMDSYIGVMKDQSPDRSFFGAILSLHRNQFKEAADYI
EKARNALDTELSALLGESYNRAYNVVVRVQMLAELEEIITYKQSAGDYEKQEAMRQTWNK
RLLGCQQNVEVWQRMLKVRALVISPRENLDMWIKFANLCRKSNRMGLAERSLSSLETVES
SEFGIPPEVTYARLKFDWAAGHQQEALQALKGFTHSLTEEYAKYNSLVNPPHAQQQQGVD
GNHMSNGHAEQREAEIAAIRQHLGDLGKFRRLLAKSHLKQGEWQTALHRGDWRSDSVRDV
LSAYSAATHYNRDSYKAWHAWALANFEVLNALSPQSNNDAVSIPHHVISEHVIPAIRGFF
RSIALSSSSALQDTLRLLTLWFTHGGDAEVNSVVTEGFATVSIDTWLEVTPQLIARINQP
NPRVRDSVHRLLAELGKAHPQALVYPLTVATKSNVVRRSELASYIMDSMRQHSPKLVEQA
EIVSHELVRVAVLWHELWYDGLEEASRLYFANHNVEGMFATLAPLHDMLDKGAETLREVS
FAQAFGRDLAEARHFCNRYREKQEVGDLNQAWDLYYTVFKKIDRQVRHMRTLDLKYVSPK
LKDVADLDLAIPGTYQSGKPVIRIMSLDPVLILVQTKKKPRKMIIKGSDGNSYMYNLKGH
EDIRQDERVMQLFGLINTLLEKDNECFKRHLIIQRFPAIPLSQNSGLIGWVTNTDTLHAL
IKEYRESRRILLNIEQRIMLQMAPDYESLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKS
SESWLERRTNYTRSLGVMSMAGYILGLGDRHPSNLLLDRITGKIVHIDFGDCFEVAMHRE
KYPERVPFRLTRMLTFAMEVSNIEGSYHITCGAVMRVLRENKESLMAVLEAFIHDPLINW
RLGARESPAQPSFADRRQSTELNLDHPLQPGNFARRRPSILDGGILDAQQGVPNEAREVQ
NARALQVLGRVREKLTGRDFKSHEELSVVDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7191 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagcatcatcagtcgctgatgccacacagaagctctttctagagctcaagtct
aaaaacgaggaaacccggcatcgagccgcacttgaattatacgacaatgtagtagcggtc
tctagagaactcccgcaagacaaattccttgaatactacaatactgtcagcggacggata
gctcaactggtggttacgggaagtgatgcgaatgagaaaatcggcggattacttgcgctt
gacaggctaatcgactttgatggcgtcgatgctgctcaaaaaaccacccggttctctggt
tacttgcgtagcgcgttgaaaagcaatgacaacaccgtccttctttatgccgccacgtct
ctcggccgtttagcaaaaccaggtggcgccctaaccgcggaacttgtggaaagtgagata
caatctgcgttagaatggctacaatcagagcgacaggagaaccggcgttttgctgctgtg
ctggtcatcagagaacttgccaaaggatcaccaacacttctctacgggtttattgcacag
atcctggaactcgtttgggtcgcccttcgtgacccaaaagtccttatccgggaaacctct
gccgacgcaatcagccaatgctttgaaatcatttctgctcgagatagccaggtccgacat
caatggtttgcggggatttatgacgaaactctactcggcctaaggtcaacgaacgtggat
tggattcatgggtccttattagcccttagggagttacttcttaagggggctatgtttatg
aacgagcattatcgcaatgcttgtgagatagtactccgattaaaagaccaccgagacccc
aaaattcgaatccaggttgccgcaactatcccagttcttgcatcttatgctccgctggat
tttacgaatacctatcttcataggtttatgatatatctccaggcccaattaaagcgggac
aaagaacggaatgccgccttcattgccattggcaagattgctagcgccgtaggtaatgca
attgggcaatttctcgacgggataatcgtgtatatccgcgagggcttgaccttgaaagcg
cgtaaccgtgctgctgtgaacgaagctcctatgcttgaatgcttaagtatgctagcgtta
gcagtggggcagacgttgagcaaatatatggaatctctcctcgaccctatctttgcttgt
ggtttgagcaaggcccttacccaggcgctcgttgatatcgcgcattatatcccgcccatc
cgagccaccatccaagaaaagctccttgacatgctgagcttggttttgtgcggaaaacca
tttcagcctctgggttgcccagacaatcgcgccccgcccatgccatcctttgtcaaagat
tctacacagccgccccaagaagccactgacagcgagattactcttgctctgctgacgctc
ggcagtttcgacttttctggccatatattgaacgagttcgtgcgtgatgtcgcaataaaa
tatgtcgataacgataatgctgagattcgtaaagcctccgcattaacctgctgccagctg
tttgtgcatgatcctatcttaaatcaaacgagcagccattctctccaagttgtcagccag
gtcatcgacaagctgctgtctgtgggagttggggacccagagcctgagattcgctgcaca
gtactgcagtcgctggatcagaaattcgatcgtcatttagccaaaccggaaaacgttcgt
tgtcttttccttgccgtcaacgatgaagtttttatggtgcgagaagctgcaattagtatc
atcggtcgtttatcaaacgttaatcctgcttatgttttcccgcccctgcgaaaattgctc
gtcaacctcctaacagggctcagtttcgccacgactccacgccagaaggaagaaagcgct
caattgataagcttgtttgtttcaaatgcaacgaaactcgttcgttcgtatgtcgacccg
atgataacaacattattacccaagacgacagatttcaaccctgctgtgtctgctactact
attaaggctattggggaacttgcaaccattggcggtgatgacatgaagcaatacttacct
cagatcatgcctattattttagatgcattgcaggatctatcatcaccttcgaaaagagaa
gcggctttacgcacccttggacagctggcgagcaatgctggatatgtcattgaaccttat
aaggagtacccacaacttcttgctgttctaattaatatcgtcaagacggaacaggctggc
tcactaagaaaagaaacgatcaagcttattggtaccctgggcgctttggacccatacaaa
tatcagcaaataagccaagatacccctgacgtccatcacatcaatgaagttcaagcagta
tccgatgtatccttaattatgcaaggtttgacgccttctaatgaagaatactatcctacg
gttgtcatcaatactctattacaaaacatcctaagcgagagctcccttgcacagtatcac
tccgccgtcatcgacgctattgttaccgttttcaagacgttgggcttgaaatgtgttcct
tttctaggacaaatcatcccggccttcatttcggttataaaaaatactccaaccagtcga
cttgaaacttatttcaaccagctggcaatattggtcacgatcgtcagacagcatatccgt
gcatttttgccagagataatagttgtcgtccgcgagtattgggatgcttcctatcaggtt
caggcaacgatattatctcttgtagaggcaatatcaaaatccctcgaaggtgaattcaaa
aaatacctagctagtctgatcccattaatgttagacaccatcgaaaaggataatagcccg
agacgccagccgtcggaaaggattctacatactttccttgtgtttgggtcaagtgccgaa
gaatacatgcacagaattatcccggcaattgttaggtcgtttgataaaccccaagcgcct
cagagcatcagaaaatcggccattgaaactttagctaagctatctcgtcaagtcaacgtg
tccgactttgcatccctcatgatccatccgttggcgagggttattggagggagtgaccgc
accttgagacagtctgcattagactgcatttgtactctaatattccagctggggcaggac
tttacgaattatatccagttaatcaacaaggttctgcatctcttacctcctttgtctgat
ttctttactaacttctggcaggtgcttaaaaacaaccaaattcatcaccacaactatcaa
atcctcatttcaaaactccaaaaaggcgaacccctgccacaggatttgaacccagatgag
cagtatggttcgtttggtgatgatcaatcctttggagaagttggccagaagaaaattctc
gtgaaccagcaacatctcaaaaatgcatgggatgcaacccaaaagtcgactcgggaggat
tggcaagagtggatgagacgtttcagcgtagagctgcttaaagaatccccatctcatgcc
cttcgagcttgtgccagcttagccggtatctaccaaccactggcaaaggatctgttcaac
gccgctttcgtttcatgctggactgaactttaccacacctaccaagaagaattagttcac
tcaatcgaccttgcacttagggcacgaaatatacctccagaaattcttcaaattctccta
aatttagccgagtttatggagcacgatgataaagcgcttccgattgacattcgaacactt
ggaaaatatgcagggaaatgccatgctttcgcgaaggcgctacattataaagagcttgaa
tttgagcaagatcagaattcgagcgcggtagaagcgttgattagcataaataatcagctt
cagcaatttgatgccgcaattggtattctccgcaaggctcaagcgtacagggacgtggag
ttaaaagagacatggtttgtaaagctgcaacgctgggaggaagcattagccgcctataaa
cgacgagaattgattgatccggattcgtttgaggtcaccatgggaaagatgcgctgcttg
catgcccttggagaatggaagatgctttcagatttggcgcaagaaaagtggaatcaagcg
tccaacgaccatcgaatatcgattgccccgcttgctgctgctgctgcctggggccgcggc
cagtggggattgatggattcatacattggagtaatgaaggatcaatcacccgatcggtcg
ttcttcggtgcgattctttccttgcatcgaaatcaattcaaagaggcggcggactacatc
gagaaggctcgtaatgcccttgacaccgaactgtccgctttgctgggcgaatcttataat
cgtgcttataacgtcgtggtccgcgtccaaatgctggctgagctcgaagaaataatcaca
tacaaacagagtgccggggattatgaaaagcaagaggccatgcgacaaacatggaataaa
cgactcttgggttgccagcagaatgtcgaagtatggcaacgaatgctcaaagtcagggct
ctagtcatttctccaagggaaaatttggatatgtggattaagtttgccaatctctgccgg
aaatctaatcgcatggggctcgccgaacgctccctcagctcgttggaaacggtcgagtcg
tctgagtttggaattccaccagaggtgacctatgcccgtcttaaatttgactgggctgca
ggtcaccaacaggaggctcttcaggcgttgaaaggctttactcattcattgaccgaagag
tacgcaaagtacaacagccttgtcaacccaccacatgcgcaacaacagcaaggcgtggac
ggaaatcatatgtctaacggacacgcggaacagagagaagctgaaatagctgcaatccgt
cagcaccttggcgatcttgggaaattccgccgacttcttgctaaaagccatctcaaacaa
ggcgaatggcagacggctttacacagaggggactggagatctgacagtgttcgtgatgtg
ttgagcgcttattccgcagctacacattacaaccgcgattcctataaagcctggcatgct
tgggcgcttgcgaacttcgaggttttgaatgctctgagtccgcagtccaacaatgatgcc
gtgtcaatacctcaccacgtcatcagcgaacatgtaatacccgctatccgtggattcttc
cggtcgatcgccctgtcatcatcaagtgctttacaggacaccttgaggcttctcacactc
tggtttacccatggaggcgatgcagaagtaaatagtgtcgtcactgaaggttttgcgacg
gttagcattgatacctggcttgaggttacgccccagcttattgcgcgaataaatcaaccc
aatcctcgggtccgcgattcagttcaccgtcttcttgcagagctgggtaaggctcatccg
caagcgttggtataccccttaactgttgcgacaaagtccaacgtggtccgccgatcagaa
ctggctagttacatcatggacagtatgcgacaacatagtccgaagcttgtcgaacaagcc
gaaatcgttagccatgagttggttcgagttgcagttttatggcatgagctctggtatgac
ggattggaagaagcatctcgactttatttcgcaaatcataacgtcgagggcatgttcgcg
accctagcgcctctacatgatatgctagacaaaggcgccgaaaccctgagagaagtgtca
tttgctcaagcttttggccgtgatctagctgaagccaggcatttctgtaaccgttatcgg
gagaaacaggaagtcggagacctcaaccaagcgtgggatctctattacacggtattcaag
aaaattgatcgacaggttcgacacatgaggacccttgacttgaaatatgtttcccccaaa
cttaaggacgtcgcagatctagatctggcaattccagggacatatcaaagcgggaagcca
gtaataaggattatgagtttggatccagtattgattttggtccaaacgaagaagaaaccg
cgaaagatgattatcaaaggtagtgacggcaactcgtatatgtacaatctcaagggccac
gaggatatccgtcaagatgagagagtcatgcaattgtttggcctgatcaacacccttttg
gaaaaggacaatgaatgctttaaacggcatttgatcattcagcgtttccctgctattcct
ttgtctcaaaactctgggttaattgggtgggtcacaaacacagacactctccatgctttg
attaaggagtatcgagagagccggcgaattctgctcaacatcgagcagcgcataatgtta
cagatggctccagactatgaaagtctgactctgatgcaaaaggttgaagtatttggttat
gccatggacaacacgactggcaaggacctctacagagtcttatggcttaagagcaagagc
tcagagtcgtggcttgaaaggcgcaccaactatactcggtcattaggtgtcatgtccatg
gcgggatacattctcggtttaggcgatcgccacccatccaaccttttgctggatagaatt
actggtaaaatcgttcatattgattttggcgattgcttcgaggtcgctatgcaccgcgaa
aagtaccccgaacgggttccattccgacttactcgcatgctcacttttgcgatggaagtt
agcaatatcgaaggaagctatcacattacttgtggagctgtcatgcgagtgcttcgagag
aataaagaatcactaatggcggttttggaggcgttcatccatgacccgttgatcaattgg
cggttgggagcacgcgagtctcctgcgcagccatctttcgctgatcgtcgccagtccact
gaactcaatctcgaccatccgctgcaaccaggcaactttgcacgtcgtcgtccttcaatt
ttggacggtggtattctcgatgctcagcagggcgtccctaacgaagctagagaagtgcag
aatgctcgtgctctccaagtactcggcagagttcgggagaaattgactggtcgggacttc
aagtcccatgaggagctcagcgtggttgaccaagtcgacaaactcttggttcaagccacg
agcgttgagaacctatgtcaacattacattgggtggtgcagcttttggtag

DBGET integrated database retrieval system