KEGG   Uncinocarpus reesii: UREG_01635Help
Entry
UREG_01635        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UREG_01635
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_01635
   00051 Fructose and mannose metabolism
    UREG_01635
   00052 Galactose metabolism
    UREG_01635
   00500 Starch and sucrose metabolism
    UREG_01635
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_01635
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    UREG_01635
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UREG_01635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 796 aa AA seqDB search
MSSSKGYLPAKAWMIVDSAACLELEAWGQDGGLDSTYRPRAFGVESAIIVIEACHQLRGT
LCIKHSTSLRELSRLLCVKYKRSQEWYPELKRYAPKRACHTLITGCCAGCLVCQFGPFAV
YGQYSAFTAPRTASFQHHRCLAVSTSNVTLPRREHSNVVKKANDDGCCSALSSPTPKSPS
ARLRSKFTALDTTLFLALHFALGDSSHSFPRKDIVDSDVSLFTRIRQILNRNLATVVMGD
SLVKAAHQLQKFFSHLVQIIHKLLNGSFRGEATGKRRRFNKRRRSLKDFAQEVEQLFIGH
LSTGRLASMSKEIRSQLRSSAQSSHINMLPSFSHSLPSGNEKGTYLALDVGGSTLRVALV
ELLGKNGEMKILRIASSHINEDVKALMGKAFFDWMAGKIEEMLQNGTEDHGKDSSPLPMG
LSWSFPIEQTSIRSGNVIAMGKGFRCSDGTVGDDLRELIMEACQKRNLNVTLEAIVNDGS
ATLLSRAYVDPTTRLSLILGTGTNMSVHFPVHAIGIEKYGKRSPEWFAQADHVITNTEIS
MFGGGVLQMTRWDDDLNRNHIKPDYQPLEYMCTGRYLGEIVRLIAVEAVQTAGLFGGHLP
ASMQARYSLDTADIACIEEDTSPSFKQSLDLIQEHHQFRIPPTPADIAFLKTISHCVSQR
ATAYLAVAIHGLWCLRNESETPILPATPESMNDDSNVKPHRKEYPKDPVRLQVNIACDGS
VINKYPNFRTRCQNYLNQLTLEPDPPQSISPTDDVVVMKEPTSSVDQLPSITLDSAPESG
IFGAAVAVAVAAPGNE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttccaagggatacctccccgccaaagcctggatgatcgttgattcagcagct
tgtttggagcttgaggcctggggacaagatggaggtttggacagtacatacagacctcgt
gcctttggggtcgagtcagcaataatcgttattgaagcttgccatcagctgcgagggaca
ctgtgcatcaagcactctactagcttgagggagctgtctcgcctgctttgcgtaaaatac
aaacggtctcaagaatggtaccccgaattgaaacgttacgccccgaaacgcgcctgccat
acgttgattacgggctgctgcgctggctgtttggtatgccaattcgggccctttgctgtg
tacgggcaatactccgccttcactgcacctcggacggcatcattccaacatcatcgctgc
ctcgccgtttccacctccaatgtcaccttgcctcgacgcgagcactccaacgtggtgaag
aaggcgaatgacgatggctgctgctccgcgcttagctcccccacgcccaagtcaccgtca
gcgcggcttaggtccaagtttactgctcttgacacaactctctttctcgctctgcatttc
gctttgggcgactcgagtcactcgttccctcgcaaggacattgttgactcggatgtttcg
ctgtttacacgtattcgccaaatcctgaatcgaaacctagctacagtcgttatgggggac
tcacttgtcaaagcagcccaccagctgcaaaagtttttcagccatcttgttcaaataatt
cataagcttttaaatggctcgttccgcggagaggccacagggaaacgacggagattcaat
aaacgtcgacgatcattgaaggactttgctcaagaagtcgagcaactttttatcggtcac
ttgtcaacagggcgccttgcatcaatgtcgaaagaaatccggtcacaactacgttcctct
gcccagtcgagccacatcaacatgctcccgtcatttagccattccctgccgtccggaaac
gagaaaggcacctatctcgccttggatgttggtggttcaacgctccgtgtcgctctggtg
gaattgctcgggaaaaatggagaaatgaaaatcttgaggatagcgtcatcgcatatcaac
gaggatgtaaaggctttaatgggaaaggccttttttgattggatggcagggaagatagaa
gagatgctccagaatggcacggaggaccacggcaaagactcatccccgttgccgatggga
ttatcctggtcctttcccattgaacaaacgtctattcgcagtgggaatgtgattgccatg
ggcaagggttttcgctgctccgatggcaccgttggtgatgacttgagagaactcattatg
gaggcgtgccagaaacgcaacctcaacgtcacgctggaagccattgttaatgatggttct
gctaccctgctttcgcgtgcttatgtcgatccgacgactcgattgtccctaatcttagga
acgggaacgaatatgtctgttcactttcccgtgcacgcgattggaatagaaaagtatggg
aaacgatcaccagagtggttcgcacaagctgaccatgtcataaccaataccgagatcagc
atgttcggtggtggggtgttacagatgacgcgttgggacgatgatttgaatcgcaatcat
atcaaaccagactaccagcctcttgagtatatgtgcaccggccggtatttgggcgaaatc
gtcaggctcattgctgtggaggccgtccagacggcaggcttgtttggcggccacctacca
gcttcaatgcaagcacgatattcactggacaccgcggacatagcatgtatcgaggaggat
acctcgccttctttcaagcaatcacttgatttaattcaggaacatcaccaatttcgcatc
cctccaacgccagcggacattgcgtttctgaaaactatcagccattgcgtctcacagcga
gctacagcttacctagcagtagcgatccacgggctttggtgcttgcgaaatgaaagcgaa
acgccaatccttcctgcaacgccggaatcaatgaatgacgatagcaatgtcaagcctcac
aggaaagagtatccgaaggaccctgttcgattgcaggtcaatatcgcctgtgatggaagc
gtcattaacaaataccccaattttcgaactcgatgtcagaattacctgaatcaattgacc
ctagaacccgatccaccccaatctatttctccaacagacgatgtagtcgtgatgaaggag
ccgacatcttcggtcgaccaactgccgtctattacactcgattcagctcctgaaagcgga
attttcggtgcagccgttgctgtcgcagtcgcggctcccggcaacgagtga

DBGET integrated database retrieval system