KEGG   Uncinocarpus reesii: UREG_01635Help
Entry
UREG_01635        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00010  Glycolysis / Gluconeogenesis
ure00051  Fructose and mannose metabolism
ure00052  Galactose metabolism
ure00500  Starch and sucrose metabolism
ure00520  Amino sugar and nucleotide sugar metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ure_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_01635
   00051 Fructose and mannose metabolism
    UREG_01635
   00052 Galactose metabolism
    UREG_01635
   00500 Starch and sucrose metabolism
    UREG_01635
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_01635
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UREG_01635
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UREG_01635
Membrane trafficking [BR:ure04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UREG_01635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8438604
NCBI-ProteinID: XP_002542119
UniProt: C4JJ28
AA seq 796 aa AA seqDB search
MSSSKGYLPAKAWMIVDSAACLELEAWGQDGGLDSTYRPRAFGVESAIIVIEACHQLRGT
LCIKHSTSLRELSRLLCVKYKRSQEWYPELKRYAPKRACHTLITGCCAGCLVCQFGPFAV
YGQYSAFTAPRTASFQHHRCLAVSTSNVTLPRREHSNVVKKANDDGCCSALSSPTPKSPS
ARLRSKFTALDTTLFLALHFALGDSSHSFPRKDIVDSDVSLFTRIRQILNRNLATVVMGD
SLVKAAHQLQKFFSHLVQIIHKLLNGSFRGEATGKRRRFNKRRRSLKDFAQEVEQLFIGH
LSTGRLASMSKEIRSQLRSSAQSSHINMLPSFSHSLPSGNEKGTYLALDVGGSTLRVALV
ELLGKNGEMKILRIASSHINEDVKALMGKAFFDWMAGKIEEMLQNGTEDHGKDSSPLPMG
LSWSFPIEQTSIRSGNVIAMGKGFRCSDGTVGDDLRELIMEACQKRNLNVTLEAIVNDGS
ATLLSRAYVDPTTRLSLILGTGTNMSVHFPVHAIGIEKYGKRSPEWFAQADHVITNTEIS
MFGGGVLQMTRWDDDLNRNHIKPDYQPLEYMCTGRYLGEIVRLIAVEAVQTAGLFGGHLP
ASMQARYSLDTADIACIEEDTSPSFKQSLDLIQEHHQFRIPPTPADIAFLKTISHCVSQR
ATAYLAVAIHGLWCLRNESETPILPATPESMNDDSNVKPHRKEYPKDPVRLQVNIACDGS
VINKYPNFRTRCQNYLNQLTLEPDPPQSISPTDDVVVMKEPTSSVDQLPSITLDSAPESG
IFGAAVAVAVAAPGNE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttccaagggatacctccccgccaaagcctggatgatcgttgattcagcagct
tgtttggagcttgaggcctggggacaagatggaggtttggacagtacatacagacctcgt
gcctttggggtcgagtcagcaataatcgttattgaagcttgccatcagctgcgagggaca
ctgtgcatcaagcactctactagcttgagggagctgtctcgcctgctttgcgtaaaatac
aaacggtctcaagaatggtaccccgaattgaaacgttacgccccgaaacgcgcctgccat
acgttgattacgggctgctgcgctggctgtttggtatgccaattcgggccctttgctgtg
tacgggcaatactccgccttcactgcacctcggacggcatcattccaacatcatcgctgc
ctcgccgtttccacctccaatgtcaccttgcctcgacgcgagcactccaacgtggtgaag
aaggcgaatgacgatggctgctgctccgcgcttagctcccccacgcccaagtcaccgtca
gcgcggcttaggtccaagtttactgctcttgacacaactctctttctcgctctgcatttc
gctttgggcgactcgagtcactcgttccctcgcaaggacattgttgactcggatgtttcg
ctgtttacacgtattcgccaaatcctgaatcgaaacctagctacagtcgttatgggggac
tcacttgtcaaagcagcccaccagctgcaaaagtttttcagccatcttgttcaaataatt
cataagcttttaaatggctcgttccgcggagaggccacagggaaacgacggagattcaat
aaacgtcgacgatcattgaaggactttgctcaagaagtcgagcaactttttatcggtcac
ttgtcaacagggcgccttgcatcaatgtcgaaagaaatccggtcacaactacgttcctct
gcccagtcgagccacatcaacatgctcccgtcatttagccattccctgccgtccggaaac
gagaaaggcacctatctcgccttggatgttggtggttcaacgctccgtgtcgctctggtg
gaattgctcgggaaaaatggagaaatgaaaatcttgaggatagcgtcatcgcatatcaac
gaggatgtaaaggctttaatgggaaaggccttttttgattggatggcagggaagatagaa
gagatgctccagaatggcacggaggaccacggcaaagactcatccccgttgccgatggga
ttatcctggtcctttcccattgaacaaacgtctattcgcagtgggaatgtgattgccatg
ggcaagggttttcgctgctccgatggcaccgttggtgatgacttgagagaactcattatg
gaggcgtgccagaaacgcaacctcaacgtcacgctggaagccattgttaatgatggttct
gctaccctgctttcgcgtgcttatgtcgatccgacgactcgattgtccctaatcttagga
acgggaacgaatatgtctgttcactttcccgtgcacgcgattggaatagaaaagtatggg
aaacgatcaccagagtggttcgcacaagctgaccatgtcataaccaataccgagatcagc
atgttcggtggtggggtgttacagatgacgcgttgggacgatgatttgaatcgcaatcat
atcaaaccagactaccagcctcttgagtatatgtgcaccggccggtatttgggcgaaatc
gtcaggctcattgctgtggaggccgtccagacggcaggcttgtttggcggccacctacca
gcttcaatgcaagcacgatattcactggacaccgcggacatagcatgtatcgaggaggat
acctcgccttctttcaagcaatcacttgatttaattcaggaacatcaccaatttcgcatc
cctccaacgccagcggacattgcgtttctgaaaactatcagccattgcgtctcacagcga
gctacagcttacctagcagtagcgatccacgggctttggtgcttgcgaaatgaaagcgaa
acgccaatccttcctgcaacgccggaatcaatgaatgacgatagcaatgtcaagcctcac
aggaaagagtatccgaaggaccctgttcgattgcaggtcaatatcgcctgtgatggaagc
gtcattaacaaataccccaattttcgaactcgatgtcagaattacctgaatcaattgacc
ctagaacccgatccaccccaatctatttctccaacagacgatgtagtcgtgatgaaggag
ccgacatcttcggtcgaccaactgccgtctattacactcgattcagctcctgaaagcgga
attttcggtgcagccgttgctgtcgcagtcgcggctcccggcaacgagtga

DBGET integrated database retrieval system