KEGG   Uncinocarpus reesii: UREG_01639Help
Entry
UREG_01639        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ure  Uncinocarpus reesii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_01639
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    UREG_01639
Enzymes [BR:ure01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UREG_01639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 925 aa AA seqDB search
MDGIGYRQMGQLFVMGFDGTSVNPQIRSLIEDYHLGSIILTAKNLKSAEETTKLVLELQT
IARDAGHSAPLMIGLDQENGGVNSLFDEIYIRQFPSSMGIAATKSKTLAREVAKATAQEL
SAVGVNWILGPVLDVLNNARSQPLGVRSIGDDAQEVSAYGVEFMKGYQEAGLVTCGKHFP
SYGNLDFLGNQSDVPVIKESLEQLSMNALVPFRNAITQGLDSMMVGGCAMSSAGMNVMHA
CLSEQVVDDLLRKDLEFKGVVVSECLEMEALSYNIGVGGGTVMAVKAGCDLILLCRSFSV
QQEAIDGLRLGVENGMISKERIQQSLKRVFDMKSRCTSWEKALNPPGISLLSKMQPSHTS
LSTRAYNNSITIVRDKKNLLPLTSTLESDEELLLLTPLIKPLPASAVSLSMSKSTRETVL
ATDAVSWDPSASIMSGESVFREFGRSLARHRNGRVLHTSYTANGVRPVHENLINRASGVI
VVTADSNRNLYQHGFTKHISMICDAQFAENGERRPKPLVVVAVSSPYDFATDQSVGTYVC
TYDFTETALQALVKILCGDLTASGSLPGTLSRNQKLQQSRQHWLAENWNEDRDANALDEL
LTAVREDGTNSQRSELAGVTSNTFLLRNPDVEEAHFVVRNSSTQALLGFCSTYFFKSTGT
GVIGALIVDPGRRKLSIGNSLHNRAIRSLMQRQGVRRFQLGSRLPGIYLGIPTGNPVERK
RLRQWFANLGWNTSLSRPVCTMVLRNLEKWTPPEGLTRSLTSAEVSYDLVYGPDYAEAIL
DHIKTNSRQGVMEIYKIALSSGSTSSGIIRAKRNDDGAILGSVVVYNGESPLAEFVPAVK
EARAVAGGISSAVISPSAGEYAILVQGLILLGIKQLRSQGASAVVLDCVDGDGNFDSLSA
MGFSVLHSFDEVTCDAATWNMLTSS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggacggcatcggttacaggcaaatgggtcagctctttgtcatgggctttgatggaact
agtgtgaatccgcagattcggtcacttatcgaggactaccatcttggttcaatcatcctg
actgctaagaatcttaaatcggcagaggagaccacgaagctcgtgctggagctacaaaca
atcgcccgagatgctgggcactctgccccccttatgattggccttgaccaagagaatggt
ggtgttaatagtctattcgatgaaatctatatccgtcagtttcccagctctatgggaatc
gcagccacgaagtcgaagactctagcaagagaggtggcgaaagctacagctcaagaactc
agcgctgttggtgttaattggatcctcggtccggttctagatgtcctaaacaacgcaaga
agccaaccattaggtgtcagaagtattggagacgatgcgcaagaggtatccgcgtacgga
gtcgagttcatgaaagggtatcaagaagcaggcttagtgacttgtggaaaacattttccg
tcttacggaaacctcgattttttaggaaaccaaagcgacgttcctgttatcaaagaaagc
cttgagcagctgagtatgaatgcgcttgtcccatttcgaaatgctatcacccaaggttta
gattcaatgatggttggtggttgtgcgatgtcatctgctggcatgaacgttatgcatgca
tgcttatcggaacaggtcgtcgatgacttacttcgaaaagaccttgaattcaagggcgtt
gtcgtgtccgagtgcttggaaatggaggccctcagttacaacattggagtaggaggggga
acagtgatggccgtgaaagctggttgcgacttgatactgctttgccgatccttctcagtt
caacaggaagcaattgatggcttaaggctaggagtcgaaaacggcatgattagcaaagaa
cgcatccagcaatcgctcaaaagagtatttgatatgaaatcccgttgcacgtcgtgggaa
aaggcattaaatcctcctggcataagccttctttccaagatgcaaccatcgcacaccagc
ctatcaactcgggcctacaacaactcaattactatcgttagagacaaaaagaacctcctc
ccgctcactagtactcttgaatctgacgaagaactcctccttctcacccctttaataaag
cctcttcccgcatcggccgtatccctttcgatgagtaaaagcaccagagaaaccgttctt
gctaccgatgcagtctcctgggatcctagtgcgtctattatgagcggggaaagcgttttt
cgcgaatttgggcggtcgttggcgcggcatcgaaatgggcgtgtactccatacttcctac
acagcaaatggagtccgccctgttcatgagaaccttatcaaccgtgcaagcggtgtcatc
gtggtcactgctgattcaaaccgaaacctttatcagcatggcttcactaagcacatttcg
atgatttgcgacgcacaatttgctgagaacggagagagacggccgaaaccgctggtagta
gtggctgtaagttctccctatgactttgccacggatcaatccgttgggacgtatgtatgc
acatatgattttacagaaacggcgcttcaagccttagtcaagatattatgcggagacttg
acggccagcggctctcttcctggtaccttgagccgtaatcagaagcttcagcaatcacgg
cagcattggcttgcggagaattggaatgaagaccgtgatgcaaacgcactagatgaactg
ctcacagccgtccgtgaggatggcacgaatagccagcgatctgaacttgccggcgttaca
tccaatacattcctgttgcgaaatccagacgttgaagaggcacattttgttgttcgaaat
agcagcacccaagctttattgggattttgctcgacatatttttttaaatcgaccggaact
ggagtcattggtgctctaatcgtcgatcccgggaggcgaaagctgtcgatcggaaactcc
ttacacaaccgtgcaatccggtcattgatgcagagacaaggcgtaagacgattccagctg
ggctcacgtctcccgggaatatatcttggtattccgacgggaaatccagtggagagaaaa
cgcctcagacaatggtttgctaatcttggctggaacacgtctttgtccagaccagtatgc
acaatggttcttcggaatctggagaaatggacgcctccagaaggtctgacccgaagttta
acgagcgcagaagtgagctatgatttggtttatgggccggattatgcagaagcaatcctt
gaccatatcaagaccaattcgagacaaggggtcatggaaatatacaagatagccctaagt
agtgggtcaacatcaagcgggattattcgcgcaaaacgaaatgatgacggcgctatcttg
ggtagcgttgttgtgtataacggggagtcgccgctggccgagtttgttcctgcagtgaaa
gaggcgcgggctgtggctggggggatctcttccgcagtcatctctccatccgccggggag
tacgcgatattggtgcaaggcctgatcctgttgggtatcaagcaattacgtagtcagggg
gccagtgcggtggttctagattgtgtggatggagacggcaatttcgatagtctctcagct
atgggattctctgtgctccacagcttcgacgaggtgacttgcgatgcggccacttggaat
atgttaacctcgtcatga

DBGET integrated database retrieval system