KEGG   Uncinocarpus reesii: UREG_01688Help
Entry
UREG_01688        CDS       T01132                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ure  Uncinocarpus reesii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UREG_01688
   00052 Galactose metabolism
    UREG_01688
   00500 Starch and sucrose metabolism
    UREG_01688
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_01688
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UREG_01688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 524 aa AA seqDB search
MASKAIPSHLRAPNPDPRSAEEGNSFVRHHGKSQSHMAFEHASTSVAASQMRNALNALAD
TVKDPKEKKRFEAEMDNFFSLFRRFLNDKARGNVLSWDRIAPPQPSQVVEYSELSNSASV
DYLKKLAVIKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPLVLM
NSFNTDDDTQSIIKKYEGHNIDIITFNQSRYPRVLKDSLLPAPKSYYSPITDWYPPGHGD
VFESLYNSGTLDKLIERGVEIVFLSNADNLGAVVDMRILEHMVKKESEYIMELTDKTKAD
VKGGTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLRAIKRVVEENALE
MEIIPNEKSISADKKGEADISIVQLETAVGAAIRFFKNAHGVNVPRRRFLPVKTCSDLML
VKSDLYTLQHGQLVMDPNRFGGAPLIKLGTDFKKVSDFQKRISSIPRILELDHLTISGAV
NLGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRILEH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaaggcaatcccatcgcaccttcgcgcccccaaccccgatcctcgctccgct
gaggaaggcaactccttcgtcaggcaccatggcaagtcgcaatcgcacatggcgttcgag
catgcctcgaccagcgtcgccgcttcgcagatgcgcaatgccctcaatgccctcgcagac
accgtcaaggaccccaaggagaagaagcgcttcgaggccgagatggacaacttcttctcc
ctcttccgccgcttcttgaacgacaaggcccgaggcaatgtcctctcctgggaccgtatt
gctcctccgcagccgagccaggtcgttgaatacagcgagctcagcaactccgcatccgtc
gactatctcaagaaattggccgtcatcaagctgaacggcggcctgggcacctccatgggc
tgcgtcggcccaaagtccgtcatcgaagtgcgcgaaggcatgtctttcctcgatctctcc
gtccgtcagatcgagcacctcaaccgcacctacaacgtcaacgttcccctcgtgctgatg
aactcgttcaataccgacgacgacacccagtccatcattaagaaatatgaaggccataac
atcgatatcattacgtttaaccagtctcgctacccccgcgtgctcaaggactctttgctc
ccagcgcccaagagctactattccccaatcacagactggtaccctcccggccacggagac
gtgttcgagtccctttacaactcgggcaccctggacaagctgattgaacgcggcgtggag
attgtcttcttgtccaacgcggacaacctgggagcagtggtcgacatgcgcattctggag
cacatggtcaagaaagaatccgagtacatcatggaactgaccgacaagaccaaggcggac
gtcaagggtggcaccatcatcgactacgagggcaaggctcgcctgctggaaatcgcccag
gtgcccaaggagcatgtgaatgagttcaagtccatcaagaaattcaagtacttcaacacc
aacaacatctggctgaaccttcgcgcgatcaagcgcgtcgtggaggaaaacgcccttgag
atggaaatcattcccaatgaaaagtccatctcggcagacaagaagggagaggctgacatc
tccatcgtccaattggagacggccgtcggggcggcaatccgtttcttcaagaacgcccac
ggcgtgaacgttccccgtcgccgcttcttgcccgtcaagacctgctccgacctcatgctg
gtcaagtcggatctctacactctccagcacggccagctggtcatggatcccaaccgcttc
ggcggcgctccgctcatcaaattgggaaccgacttcaagaaagtttccgacttccagaag
cgtatttccagcatccctcgcatcctcgagctcgaccatctgaccatcagtggagccgtc
aacctgggtcgcggcgtcactctcaagggaaccgtcatcatcgtggctacggagggcagc
acaatcgatattccacccggctccatcctggaaaatgttgttgtccagggaagtctgcgt
atcttggagcactag

DBGET integrated database retrieval system