KEGG   Uncinocarpus reesii: UREG_01769Help
Entry
UREG_01769        CDS       T01132                                 

Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ure00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MSRNDPLLVQRPSSDHSPERSDAEEDALLTGERTRRSESRRGATFWREVGLFSWALIATA
AVIVLAVVYQHGQSTGRREGRWAPGEKPEGKRNLVFMVSDGMGPTSLSMTRSFRQFQKDL
PIDDILVLDKHHIGQSRTRSSSSLITDSAAGATAFSCGKKSYNGAISVLPDHSPCGTVLE
AAKAAGYMTGLVVTTRITDATPACFSSHVNMRSYEDLIAEHQVGEYPLGRQVDLILGGGR
CHFLPNSTSGSCRGDDKDIVQLAKSKGFSYIDNRDGFDELKLGSAAQLPLLGLVAEKDIP
FEIDRRFENDVYPSLEEMARTALKALSDATRNSDKGFFIMIEGSRIDHAGHGNDPAAQVH
EVLAYDRAFAAVLEFLENDSTPGVLVSTSDHETGGLAAARQLHESYPDYKWFPGVLANAS
HSSEHLEAKLHDYLDNEGNSASADKKRAYIRREFLEKGLGIFDAQDSEIDRLINPGDQVP
AAYVFADIISRRAQIGWATHGHSAADVNIYASSPHDVLDLVGNHENIEVGQFLAKYLDLD
LGEITRKLRDTETKPHAASERYAWMGEPLADEVVVDELDTYHGDFKKRSLESKPSHEDAE
PRLRLERHSWLTFDSFSQMTDDEFGHHPT
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaacgaccccttgcttgtccaacgcccttcctccgaccactcaccggaacga
agtgacgccgaagaagatgcccttttaacaggagagcgaactcgtcgcagtgagagtcgc
cggggagcaacattctggcgcgaggttggattgttctcgtgggcattaattgcaaccgct
gcggtcatcgtcttagccgtcgtttaccagcatggacagtcaaccggtaggcgtgaagga
agatgggcgcctggcgagaaacctgaagggaaacgcaacttggtattcatggtatccgat
ggaatgggccccacaagcttatcgatgacacgaagcttccgacaattccagaaagacctt
ccaatcgatgatattcttgtgttggataagcatcacattggacaatcccgaacaagatca
tcctctagcttgattacagactccgcggcgggcgcaacggcgttttcttgcgggaaaaag
agctataatggtgccatttctgtattgccagaccatagcccatgcgggaccgtcctagaa
gccgcaaaggctgctggatatatgacaggcttggtggttacaacaagaattacggatgcc
acccccgcatgcttttcctcccatgtcaatatgcgttcgtatgaggatctaattgccgaa
catcaggttggcgaataccctctgggccgtcaagtcgacctgatccttggaggagggagg
tgtcatttcctacctaattccacgtccggcagctgccgtggtgatgataaggacatcgtg
cagctagcaaaatcgaaaggtttctcttacattgacaatcgtgatgggtttgatgaactc
aagctgggcagtgccgctcagctgccattactaggcctcgttgctgaaaaggacattcca
tttgagattgaccgccgatttgagaatgatgtatacccttccttagaagaaatggctcgc
accgccttgaaagcgttaagtgatgctacacgcaacagtgacaaaggtttcttcatcatg
attgagggctcccgcattgaccatgctggccatggcaacgatcctgctgctcaggtccac
gaagttctagcttatgacagagcctttgccgccgtgctagagtttctggaaaatgattcg
acgcctggtgttcttgtcagcacatcagaccatgaaaccggaggtttagccgcagctcga
cagctccatgagtcttatcctgattataaatggttcccaggcgtccttgccaatgccagc
cattcatccgaacacctagaagccaagctacatgattatcttgacaatgagggaaattcc
gcctctgcggataagaaacgggcctatatccgtcgtgagttccttgaaaaagggctggga
atattcgatgcccaagatagcgagattgaccgacttatcaaccccggggaccaagtacct
gcggcttacgtttttgctgatatcatcagtcgaagagcacagatagggtgggcaacccat
ggtcattccgctgccgacgtgaacatttatgcttcttctccacatgatgtcctggacctt
gttggaaaccacgaaaacatcgaagttggccaattcttggccaagtatctagacttggat
ctaggcgaaattaccagaaaactccgagatacggagactaagccgcatgccgccagcgaa
agatacgcttggatgggtgaaccgctcgccgatgaagttgtcgtcgacgaacttgatact
tatcacggtgactttaagaagcgtagtcttgaatccaaaccctcccatgaagacgccgaa
ccccgcctcagactggaaaggcactcatggctgacgttcgatagcttcagccagatgaca
gatgacgaattcggccaccaccccacatag

DBGET integrated database retrieval system