KEGG   Uncinocarpus reesii: UREG_01826Help
Entry
UREG_01826        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00838  
aromatic amino acid aminotransferase I [EC:2.6.1.57 2.6.1.27 2.6.1.5]
Organism
ure  Uncinocarpus reesii
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Phenylalanine biosynthesis, chorismate => phenylalanine
Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    UREG_01826
   01230 Biosynthesis of amino acids
    UREG_01826
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    UREG_01826
   00300 Lysine biosynthesis
    UREG_01826
   00350 Tyrosine metabolism
    UREG_01826
   00360 Phenylalanine metabolism
    UREG_01826
   00380 Tryptophan metabolism
    UREG_01826
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UREG_01826
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    UREG_01826
Enzymes [BR:ure01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     UREG_01826
    2.6.1.27  tryptophan transaminase
     UREG_01826
    2.6.1.57  aromatic-amino-acid transaminase
     UREG_01826
Amino acid related enzymes [BR:ure01007]
 Aminotransferase (transaminase)
  Class I
   UREG_01826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MSPHAAQDAAARDVADITGEMPEPLTVAGVPARRAKTMLPTGIAASCHSDMFKSLACYSR
PKAHRWDKYISVESKSRKASSLKQAAHYLDNPGLISLGGGLPSAEYFPFDEISIKVPVAP
NFSEQETRESGQVLTAGKYDIREGKSEYGVFQGLTMTMIGRPANSILRSVEIAFFSTIVH
NPPYSDWQCSLTAGSTASWDMVLRLFCNRGDYILTEEYSFASAMETALPQGLRLAPVKMD
EQGLLPSSLDEVLSNWDVSARGARKPFVLYTVPSGQNPTGATQDASRRKEVYKVAQKHDI
IIVEDEPYYFLQMQPYKGANAPQDPPPADYNEFLKALIPSFLSLDVDGRVVRLESFSKVL
SPGSRTGWLVASEQIVERFLRNAETSTQNPSGMSQIILFKLLDEAWGHEKYLQWLIHIRM
GYTSRRNVMLEACEKFLPTSVASWHPPAAGMFHWIKVDWRKHPLARAGKSYDCVEETIFK
AAVDEGVLICRGTWFAADTSKEPTDMFFRATFAAAPADKIQQAIKRFGDTLRAQFELK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctccccacgccgcgcaagatgctgctgcacgcgatgttgcggatattactggagaa
atgccggagcccttgaccgtcgccggcgtacccgcccgaagagcaaagacaatgctaccg
accggcattgctgcgtcttgtcatagtgacatgttcaagagtctggcatgctattcgaga
ccaaaggcgcatcgatgggataagtatatttcggtcgaaagcaaatcgcgaaaggcgtcg
tccctaaagcaggctgcgcattatttggacaatccaggattgatatcgcttggcggaggc
ctcccttcggctgaatatttcccattcgacgaaatctcaatcaaagtcccagtcgcgcca
aacttttcggagcaagagacgcgcgagtcaggacaggttctcacggcaggcaaatatgac
attcgagagggaaagagtgaatacggtgtgtttcaagggctcactatgacgatgattggg
cggccggctaacagcatactgaggtcggttgagattgcctttttcagtacaatagttcat
aacccgccgtattccgattggcaatgctcactcactgctggtagcacggcttcgtgggat
atggtgctccgtttattctgcaaccgtggggattatatcttgaccgaggaatattcattt
gctagtgctatggagacggcgttgccccaaggccttcgcctagccccggtcaaaatggac
gaacagggacttcttccttcctccctcgatgaggttctgagcaactgggacgtatctgca
cgtggcgctcgaaagcccttcgtgctttacactgtgccatccggacaaaatccgacaggc
gcgactcaagatgcttcgagaagaaaggaggtgtacaaagttgcgcaaaagcacgatatt
attattgtggaagacgagccatactacttcctccaaatgcagccatataaaggagcgaat
gcgccgcaagatcctccgccggccgattacaacgaatttttaaaggctcttatcccgtct
ttcctcagccttgatgtggatgggcgcgtcgtacgcctcgagtccttttcaaaggtcctg
tcaccgggttcccgtaccggttggcttgttgcttccgaacagattgtggagcgattcctt
cgaaatgctgagacttctacgcagaatccaagcgggatgtcccagatcattctgtttaag
ctgctagatgaggcttggggccatgagaaatacctgcagtggttgatccatattcgtatg
ggatacaccagccgaaggaacgttatgctcgaagcctgtgagaagtttttgcccaccagc
gttgcatcctggcatcctccagcggcaggcatgtttcactggattaaagtcgattggaga
aagcatccacttgctcgcgcaggaaaatcttatgattgcgttgaagaaaccatctttaaa
gcggcagtggatgagggcgttttgatttgccgtggcacttggttcgcggcagatacgtcc
aaagagccaacggatatgttcttccgggcaacattcgcggctgcacccgccgataaaatc
cagcaggcgattaagcgatttggagatactctgagggcgcaatttgaactcaaatga

DBGET integrated database retrieval system