KEGG   Uncinocarpus reesii: UREG_01826Help
Entry
UREG_01826        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00838  
aromatic amino acid aminotransferase I [EC:2.6.1.57 2.6.1.27 2.6.1.5]
Organism
ure  Uncinocarpus reesii
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Phenylalanine biosynthesis, chorismate => phenylalanine
Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ure01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ure01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ure00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ure00300]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ure00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:ure00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ure00380]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ure00400]
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:ure00130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MSPHAAQDAAARDVADITGEMPEPLTVAGVPARRAKTMLPTGIAASCHSDMFKSLACYSR
PKAHRWDKYISVESKSRKASSLKQAAHYLDNPGLISLGGGLPSAEYFPFDEISIKVPVAP
NFSEQETRESGQVLTAGKYDIREGKSEYGVFQGLTMTMIGRPANSILRSVEIAFFSTIVH
NPPYSDWQCSLTAGSTASWDMVLRLFCNRGDYILTEEYSFASAMETALPQGLRLAPVKMD
EQGLLPSSLDEVLSNWDVSARGARKPFVLYTVPSGQNPTGATQDASRRKEVYKVAQKHDI
IIVEDEPYYFLQMQPYKGANAPQDPPPADYNEFLKALIPSFLSLDVDGRVVRLESFSKVL
SPGSRTGWLVASEQIVERFLRNAETSTQNPSGMSQIILFKLLDEAWGHEKYLQWLIHIRM
GYTSRRNVMLEACEKFLPTSVASWHPPAAGMFHWIKVDWRKHPLARAGKSYDCVEETIFK
AAVDEGVLICRGTWFAADTSKEPTDMFFRATFAAAPADKIQQAIKRFGDTLRAQFELK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctccccacgccgcgcaagatgctgctgcacgcgatgttgcggatattactggagaa
atgccggagcccttgaccgtcgccggcgtacccgcccgaagagcaaagacaatgctaccg
accggcattgctgcgtcttgtcatagtgacatgttcaagagtctggcatgctattcgaga
ccaaaggcgcatcgatgggataagtatatttcggtcgaaagcaaatcgcgaaaggcgtcg
tccctaaagcaggctgcgcattatttggacaatccaggattgatatcgcttggcggaggc
ctcccttcggctgaatatttcccattcgacgaaatctcaatcaaagtcccagtcgcgcca
aacttttcggagcaagagacgcgcgagtcaggacaggttctcacggcaggcaaatatgac
attcgagagggaaagagtgaatacggtgtgtttcaagggctcactatgacgatgattggg
cggccggctaacagcatactgaggtcggttgagattgcctttttcagtacaatagttcat
aacccgccgtattccgattggcaatgctcactcactgctggtagcacggcttcgtgggat
atggtgctccgtttattctgcaaccgtggggattatatcttgaccgaggaatattcattt
gctagtgctatggagacggcgttgccccaaggccttcgcctagccccggtcaaaatggac
gaacagggacttcttccttcctccctcgatgaggttctgagcaactgggacgtatctgca
cgtggcgctcgaaagcccttcgtgctttacactgtgccatccggacaaaatccgacaggc
gcgactcaagatgcttcgagaagaaaggaggtgtacaaagttgcgcaaaagcacgatatt
attattgtggaagacgagccatactacttcctccaaatgcagccatataaaggagcgaat
gcgccgcaagatcctccgccggccgattacaacgaatttttaaaggctcttatcccgtct
ttcctcagccttgatgtggatgggcgcgtcgtacgcctcgagtccttttcaaaggtcctg
tcaccgggttcccgtaccggttggcttgttgcttccgaacagattgtggagcgattcctt
cgaaatgctgagacttctacgcagaatccaagcgggatgtcccagatcattctgtttaag
ctgctagatgaggcttggggccatgagaaatacctgcagtggttgatccatattcgtatg
ggatacaccagccgaaggaacgttatgctcgaagcctgtgagaagtttttgcccaccagc
gttgcatcctggcatcctccagcggcaggcatgtttcactggattaaagtcgattggaga
aagcatccacttgctcgcgcaggaaaatcttatgattgcgttgaagaaaccatctttaaa
gcggcagtggatgagggcgttttgatttgccgtggcacttggttcgcggcagatacgtcc
aaagagccaacggatatgttcttccgggcaacattcgcggctgcacccgccgataaaatc
cagcaggcgattaagcgatttggagatactctgagggcgcaatttgaactcaaatga

DBGET integrated database retrieval system