KEGG   Uncinocarpus reesii: UREG_02065Help
Entry
UREG_02065        CDS       T01132                                 

Definition
MAP kinase kinase skh1/pek1
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ure  Uncinocarpus reesii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UREG_02065
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     UREG_02065
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   UREG_02065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 508 aa AA seqDB search
MSSPAPLLKIPTPGNRKPPKLTVGIPPSPNARPVNQVGTASYDDPHAQQFPARQLPPELR
IATPMGSRGTIPQENTSYYNGRPMQQQPQPYNASSHDLSAHSRSGSFTMHDGKTSGPASA
TSSSFSTLSFAMGMRDPLGATRDPSSAISSVYSDREGGMPMERENSMNGILPDLDKLSHE
LGRPLDVEDLDDEKWTAASEQGKIIELDSLGEGAGGAVTRCILIGGKTVFALKVITTDPN
PDVKKQIFRELNFNKGCASEHICRYYGAFMDRSSSTISIAMEFCEGGSLDSVYKEVKKLG
GRTGEKVLGKVAEGVLNGLTYLHGRKIIHRDIKPSNILLCRTGQVKLCDFGVSGEFGTKG
DANTFIGTSYYMAPERITGKSYTITSDVWSLGVTLLEVAQHRFPFPADGTVMQPRAGLID
LLTYIVRQPIPKLKDEPGNGIYWSDNFKYFIECCDAKISANSNHRSLEKEPPRRATPWRM
LEHPWMLEMKNKKVNMAHFLKQVWDWND
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcccgctcctctcctaaagatccccacgccgggaaaccgaaagccgcccaag
ctcacagttggcatccccccttcaccgaacgctcgccccgtcaaccaagttggcaccgct
tcatacgatgacccacacgcccaacaatttcccgctcgccagctgcccccggagttgagg
attgcaacgcccatgggtagcaggggaacaatcccacaggaaaacacctcctactacaat
ggccggccaatgcagcaacaaccacaaccctacaacgcctcttcacacgacctctcggca
cattcacggtctgggagctttacgatgcatgatggcaaaaccagtggcccggcatctgca
acttcttcgtcgttttctactctctcgtttgccatggggatgagagatccccttggagcc
accagggatccgtcgtccgcaatcagctccgtatattccgaccgcgaaggcgggatgccg
atggaacgagagaatagcatgaatggcattttacctgatctggataaactgagccatgaa
ctgggcaggcccttggatgttgaagatctcgatgacgaaaagtggacagctgctagcgag
caagggaagatcattgaacttgacagcctcggcgaaggtgccggtggagcggtcaccaga
tgcatactaataggcggaaaaacggtgttcgctctaaaggtcatcacaaccgatcctaac
cctgacgtgaagaaacaaatatttcgagaactaaattttaataagggctgtgcatcagaa
catatttgccggtattatggggcgtttatggataggtcgtcaagcacaatatctatcgcg
atggagttttgtgaaggcggcagcctcgacagtgtctacaaagaggtcaagaagcttggt
ggccgaactggagaaaaggtgttaggaaaggttgctgaaggcgtattaaacggtttaacg
tacctgcatggacgcaaaatcatccacagagacatcaaaccgtcgaatatcctcctctgc
cgaacagggcaagtcaaactctgcgatttcggtgtcagcggcgagttcggcacaaaaggc
gatgcaaacactttcattggcacatcgtattacatggcgcccgaacgaattactggcaaa
tcttatacgattacgtccgacgtttggtctctcggagtcaccttgctcgaagttgcgcag
caccggtttcctttcccagcagatgggacggtgatgcagccaagagcaggcttgattgat
ctcctaacgtacattgtccgacaaccaatccccaagctgaaagacgaaccagggaatgga
atctactggagcgataactttaaatactttattgagtgctgcgacgccaaaattagtgct
aattcgaatcatcgcagtttggagaaagagcctccccgaagagcaactccatggcgcatg
ttggagcacccctggatgcttgagatgaagaataagaaggtcaatatggcgcatttcttg
aagcaagtttgggactggaatgattag

DBGET integrated database retrieval system