KEGG   Uncinocarpus reesii: UREG_02203Help
Entry
UREG_02203        CDS       T01132                                 

Definition
protein kinase YAK1
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ure  Uncinocarpus reesii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 858 aa AA seqDB search
MDPQWPAYTDSTGNRAANQFGNGHPSQMAPKYPAPGPGGQVQQPQAPLGYSYETYQSPTA
TNPPPLPSNAKSISMTSSPSATPLTREFVDLDTPMEDADPYNRSKYPVRPSPTRTNTYTG
PSQTYQSPPSGAPSRPQAPRLPPIQSTDMSLEQFYPQNATLQLHTAFSQNQKTQPTHLNQ
STSVPETPVRRGPVPRFQKIKSTQELKPKIAAQPALRRANPEGGFISPLQALTTHLPATY
RICNPTFKYESSRNPRRVLTKPSKGTKNDGYDNDDSDYILYVNDILGSEEGNHKNRYLIL
DVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLINSKLDKNDDHHL
LRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKARL
IHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAID
MWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGMPPTWMIEMGKQAGDFFEKTQDEFG
RRSYRLKSLEQYSREHNTKEQPSKRYFQSNNLSEIIRNYAMPRKNMKQAEIDRELNNRVA
FTDFVRGLLTINPLERWSPQQAKLHPFITQQKFTQPFVPPMNLKSSVVNKSVAPGVQQQQ
QAEAASKQRAVQEAQAQAQAQVQAQSAAQSAYAMQMGQYNPATHSQPPPVYNNIYSGHQQ
GAPLPYPAQQSGYGHQMGMMQTPTHIPQQSYGASQSLYAQATTRAGRQRASTMDQQQSGI
PPAIQRVASHLDPNAPIRLQPSPAYYPPPADGYPEGTTSGNRRRGSRVGGSQGRNRDFIR
NLEDGALGDGFMAQNQWR
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcagtggcccgcttacaccgattcaacaggaaacagagcagccaaccaattt
gggaatggtcatccgtcgcaaatggctccgaagtatccagctcctgggcctggaggccag
gtgcaacaaccacaagctccgttaggctactcctatgagacgtatcaaagtcccaccgct
acaaatcctccacctttaccttccaacgccaaatctatctctatgacatcgtcaccttcc
gcaaccccgcttacgcgggagtttgtcgaccttgacaccccgatggaagacgcagatcct
tacaatcgatctaaatatcctgtcagaccatctcccacgaggacaaatacctacactggg
ccgtctcaaacctaccaatctccgccatctggtgcaccttcaagaccgcaagctccgcga
ttacccccaatacagtcaacggatatgagccttgaacagttttacccgcagaacgccacg
cttcagcttcataccgctttttctcaaaaccaaaagacccagccaacacatctgaaccag
tcgacctctgtcccagagacccctgttagaagagggccggtgccgaggtttcaaaagatc
aaatcaacacaagagctgaagccgaaaatagctgcccagcccgccctgcgtcgtgcgaac
ccggaaggcggtttcattagccccctacaagcccttacaactcatttaccagccacgtac
cggatatgtaacccgaccttcaaatacgagtcctcgaggaacccacgtcgagtattaacc
aagcccagtaaaggaaccaaaaatgatgggtacgataatgatgacagcgattatatccta
tatgtaaatgatattctgggaagtgaggaggggaatcacaagaaccggtacctaattctg
gatgtgcttggacagggaacatttggtcaagtcgttaagtgccagaacttaaaaacacaa
gaagtagtagctgtcaaggttgtaaagaaccgaacggcgtactttaaccagagcatgatg
gaagtctcagttcttgacctgattaatagtaagctggacaaaaatgatgaccatcatctt
ttgcggctgaaagatacttttattcaccggcagcatctatgcttggttttcgagcttctc
agtgtgaacctgtatgaactgatcaagcagaatcaatttcgtgggcttagtacaacactg
gtccgtgtttttgctcaacagcttctaaatggattggctttactcaacaaagcccgctta
atccattgtgatttgaagccggagaacattctgctcaaaaatcttgagagcccgatcata
aaaatcatagatttcggatctgcttgcgatgaaaggcagactgtgtatacatatatccag
tctcggttctaccgctcgcctgaagtcttgttgggcctgccatattcatccgccatcgat
atgtggtcgctgggttgtatcgttgttgaacttttccttggcttgccattattccccgga
tcttccgagtataaccaggtgtccagaatagtggaaatgctaggcatgccaccaacttgg
atgatcgaaatgggaaagcaagctggtgatttcttcgaaaagacccaagacgagttcggg
agacggagttataggctcaaaagtctagaacagtactcgcgagaacataacaccaaagaa
cagcctagcaaacggtatttccagtcgaacaatctgagcgagatcattcgtaactatgca
atgcctaggaagaacatgaaacaagcagagattgatagagaattaaacaaccgagttgcg
ttcactgattttgttcgcgggttattgacaatcaaccccttggaaagatggtccccgcaa
caagcaaaactgcatccgttcataacccaacaaaagttcactcaaccatttgtgccacca
atgaacctgaaatcatcagtggttaataaatccgttgcacccggtgtccagcaacaacaa
caagccgaagctgccagcaaacaacgtgcggtccaggaagcccaagcccaagcccaagca
caggttcaagctcagtccgccgcgcagtctgcatatgcaatgcagatgggccaatataac
ccagctactcacagccaaccgccaccagtgtacaacaatatatacagtggtcaccaacaa
ggggctcctctaccatatccagcccaacaatcgggatacggtcatcaaatgggaatgatg
caaacccctacgcatatcccacaacaatcatatggagcctcgcaaagcctttacgctcaa
gcgacaacgcgggctggccgacaaagagcttccaccatggatcagcaacagagtggcatc
cctcccgcaattcaacgggttgctagtcacttggatccgaacgcgcctattcgcctacaa
cctagccctgcatactatcctccaccggcagacggctatcccgaaggaactacgtcagga
aataggcgaagagggagccgtgtaggtgggtcgcaaggtcggaaccgggatttcatccgc
aaccttgaggatggtgcacttggagacgggtttatggcccaaaatcaatggcgctga

DBGET integrated database retrieval system