KEGG   Uncinocarpus reesii: UREG_02222Help
Entry
UREG_02222        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ure  Uncinocarpus reesii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UREG_02222
Enzymes [BR:ure01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     UREG_02222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 709 aa AA seqDB search
MKTGLWAVSLLAAVLRPVFAGSNNLEKRADDKPSDDGSDKSTVFDGVRVPPLKEFNAADF
EEGIKDGYWFVKYYSPYCHFCEAVRPTFQTLYEFYYTSNPLKSSTSKQTSSPESSLNSFQ
GYYDFRFASMNCVVNGDKCMELDVGEWPTFALYRKGELVEKFKGNNDMKGLSGFIEKWLE
SIKPGSRPRTEMKLPEPGAKSAPEQPKENDKVLAGDDGAPASSKQPGRGADNQLPTPNPQ
GISVPLTAESFQKLVTTTRDPWFVKFYAPWCSHCQALAPIWSQMAKDLKGKLNIGEVNCE
VEKRLCKDARVNLYPTMYFFRGGERVEYEGLRGLGDLVNYAKKAVDVVGRGVQYVDAAAF
KKMEETEEVIFLYFFDHATTSEDFAALDRLTLSLVGRARLVKTNSSVLAERFKISTWPRL
LVSRDGRPTYYTALAPKDMRDFRQVLTWMQKVWLPIVPELTASNAKEIMERKYVVLGILN
RQRSDEFIQDKRELKNAAMEWMEKQTKLFQLERQELRDAKELRIEEADDRDDQRALRAAK
NTRITIKEDDKKQVAFAWVDGIFWDRWIRTTYGIDVRNGERVIINDEENRRYWDTTPNGG
FIVPSRTSILETITHVVSSPSKLSSKSTVGTFESIFFSIRTFITSHPIITLLLIAASLIV
ASSVARGKLRRGRSGGGLLGNVGGSSGGFFHLDGKEGLLGSGGGSGKVD
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaagactggcttgtgggcggtctcccttctagctgccgttttacggccagtgtttgcc
gggtcgaacaatttagagaaaagggcggatgacaaacctagcgatgatggatcggataag
tcgacagtattcgacggtgtacgtgtgccgccattgaaagaattcaatgctgcggacttt
gaagagggtatcaaggatggttactggtttgttaaatactattctccttattgtcatttc
tgtgaggccgttcgacccacattccagactctttatgaattttactatacatccaatcca
ttaaaatcatccacatcgaaacagacttcaagcccagaatcctccctcaactccttccag
ggctattacgactttcggttcgcgtcgatgaactgtgttgtaaacggagacaaatgtatg
gaattggacgtcggggagtggccgacctttgccctctatcgcaaaggagaactggtcgaa
aagtttaaagggaataatgatatgaaaggtctcagcggattcattgaaaaatggctagaa
tcaatcaaacctgggtcacgacccagaacggaaatgaaactgccggaacctggtgcgaag
tccgctcctgaacagccaaaggaaaatgacaaagttttggctggcgatgacggtgcaccc
gcttcttcaaaacagccaggtcgcggtgccgataaccagctaccgactcccaatccccaa
ggcataagcgttcctctaacggcagaaagcttccaaaaactcgtcactacaacgagagat
ccatggtttgtgaagttttacgctccatggtgttctcattgtcaggcccttgccccaatt
tggagccagatggccaaggatttgaaaggcaagctgaatataggcgaagtcaactgcgag
gttgagaaaagactttgcaaagatgctcgtgttaatctctatccgacgatgtatttcttc
cgtggaggcgagcgggttgaatatgaaggactacgaggtcttggtgatctcgtaaactat
gctaagaaggctgttgatgtcgtcggcagaggcgtccaatatgtggacgccgcagcgttc
aagaagatggaagagaccgaagaagttattttcttgtacttcttcgaccatgccactact
tcggaggattttgcagcattggaccgattgacacttagtcttgtcggccgtgcccgtctc
gtcaagaccaacagcagcgtccttgctgagaggttcaagatatcaacatggcctcgtctc
cttgtttcaagggacggtagaccaacttattatactgcgctagctcccaaggatatgaga
gacttccggcaagtcttaacatggatgcaaaaagtttggttgccaatcgtcccagaactg
acggcatcgaacgcaaaggaaatcatggagaggaaatacgttgttctcggtatcctcaat
aggcaacgatccgatgaattcattcaagataaacgggaactcaaaaatgcagctatggag
tggatggaaaagcaaacaaaactattccaactggagcgccaagaactgcgcgatgcaaaa
gaactgcgcatcgaagaggccgatgatcgcgatgaccaacgagctttgagagccgccaag
aatactcgcattactatcaaggaggacgataaaaaacaagttgcctttgcctgggttgac
ggaattttctgggatagatggattcggacgacctatggcattgatgttaggaatggagaa
cgtgttatcattaatgatgaagagaatcgccgatattgggataccacgccaaatggaggt
tttattgtccccagccgcacgtccattttagaaaccattacccacgtcgtttcgtctcct
agcaaactcagttccaaatcgaccgttggaactttcgaaagcattttcttttccatccga
acatttatcacctctcacccaatcatcacacttctattgattgccgcttctcttatcgtc
gcctcaagcgtagctagaggcaaactacgaagaggtagatctggcggcggtctattgggc
aacgtcggaggcagctctgggggattcttccatcttgacggaaaggaaggattgcttggt
agtggcggtgggagcgggaaagttgattaa

DBGET integrated database retrieval system