KEGG   Uncinocarpus reesii: UREG_02367Help
Entry
UREG_02367        CDS       T01132                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
ure  Uncinocarpus reesii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_02367
Messenger RNA biogenesis [BR:ure03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     UREG_02367
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     UREG_02367
Translation factors [BR:ure03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    UREG_02367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MAAAVAGNVVAPVPDENTPPNGAEAGLKGDEEVTVFHDPNNFNVKHPLMNEWTLWFTKPS
SGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRPEWEDQHNKH
GGKWSFQFKDKRSVPIDELWLHSQLAAIGETLENDGDNEVMGVVVNVRKGFYRIGLWTRT
TGKPLPASDKRTVDKSEEILKAIGRRFKEVLRLKDTDQLEFSGHTESATAGSTRAKAKFV
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcagttgcaggaaatgtcgtcgctcccgtaccagacgagaacacaccccca
aatggtgcggaagctgggctaaaaggcgatgaagaggtcacagttttccatgacccaaac
aatttcaacgtgaagcatcctctgatgaacgagtggacactatggtttacaaagccttca
agtggcaagggcgataactggaatgatctcctaaaagaagtcgtaacatttaattccgtt
gaagagttttggggtatctacaacaacatcacaccaacttcagagctcggtttgaaagcg
gattatcaccttttcaaaaaaggtattcgaccagaatgggaagatcaacataacaagcat
ggcggaaaatggtcgtttcaattcaaagataagcgtagcgttcctattgacgagctctgg
ctccactctcagctcgccgccatcggtgagactctcgaaaacgatggtgataacgaagtg
atgggtgttgtggtcaatgtgcgcaaaggattctaccgtatcggtctctggacaagaacc
actggaaagcctctaccggcttctgataaacgcactgtcgacaaaagcgaggagattttg
aaagcaatcggtagaaggttcaaggaggttctgaggttgaaggatacagatcagttagaa
ttttctggccataccgaaagcgctactgcaggaagcaccagagctaaggcgaagtttgtg
gtttga

DBGET integrated database retrieval system