KEGG   Uncinocarpus reesii: UREG_02367Help
Entry
UREG_02367        CDS       T01132                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-1
  KO
K03259  translation initiation factor 4E
Organism
ure  Uncinocarpus reesii
Pathway
ure03013  RNA transport
Module
ure_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_02367
Messenger RNA biogenesis [BR:ure03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     UREG_02367
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     UREG_02367
Translation factors [BR:ure03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    UREG_02367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 8439184
NCBI-ProteinID: XP_002542851
UniProt: C4JFN3
AA seq 241 aa AA seqDB search
MAAAVAGNVVAPVPDENTPPNGAEAGLKGDEEVTVFHDPNNFNVKHPLMNEWTLWFTKPS
SGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRPEWEDQHNKH
GGKWSFQFKDKRSVPIDELWLHSQLAAIGETLENDGDNEVMGVVVNVRKGFYRIGLWTRT
TGKPLPASDKRTVDKSEEILKAIGRRFKEVLRLKDTDQLEFSGHTESATAGSTRAKAKFV
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcagttgcaggaaatgtcgtcgctcccgtaccagacgagaacacaccccca
aatggtgcggaagctgggctaaaaggcgatgaagaggtcacagttttccatgacccaaac
aatttcaacgtgaagcatcctctgatgaacgagtggacactatggtttacaaagccttca
agtggcaagggcgataactggaatgatctcctaaaagaagtcgtaacatttaattccgtt
gaagagttttggggtatctacaacaacatcacaccaacttcagagctcggtttgaaagcg
gattatcaccttttcaaaaaaggtattcgaccagaatgggaagatcaacataacaagcat
ggcggaaaatggtcgtttcaattcaaagataagcgtagcgttcctattgacgagctctgg
ctccactctcagctcgccgccatcggtgagactctcgaaaacgatggtgataacgaagtg
atgggtgttgtggtcaatgtgcgcaaaggattctaccgtatcggtctctggacaagaacc
actggaaagcctctaccggcttctgataaacgcactgtcgacaaaagcgaggagattttg
aaagcaatcggtagaaggttcaaggaggttctgaggttgaaggatacagatcagttagaa
ttttctggccataccgaaagcgctactgcaggaagcaccagagctaaggcgaagtttgtg
gtttga

DBGET integrated database retrieval system