KEGG   Uncinocarpus reesii: UREG_02417Help
Entry
UREG_02417        CDS       T01132                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ure  Uncinocarpus reesii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ure01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ure01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MASQEAVAVESSKAPSTGNDNKKLHITDTPVTLSTWHKHVNWLNVILILMVPLYGCVQAY
WIPLQIKTAIWAVLYYYMTGIGITAGYHRLWAHCSYSATLPLRIYLAAVGGGAVQGSVRW
WARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITDLNEDPVVVWQH
RNYLKVVLTMGLIFPTIVSGLGWGDWWGGFIYAGILRVFFVQQATFCVNSLAHYLGEQPF
DDRNSPRDHVLTALITMGEGYHNFHHEFPSDYRNAIEWHQYDPTKWIIWVWKQVGLAYDL
KQFRANEIEKGRIQQLQKKIDQRRANLDWGVPLEQLPVMEWDEYVEQAKNGRGLIAIAGV
VHDVTNFIKDHPGGKAMINSGIGKDATAMFNGGIYNHSNAAHNLLSTMRVGVIRGGCEVE
IWKRSQRENKDIESARDAYGQRIIRAGEQVTKLPEPVPSAGAA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcaagaagccgtggctgtagagtcctccaaggctccctcgaccggaaatgac
aacaagaagcttcatatcacagataccccggtcacactgtccacctggcacaagcatgtc
aactggttaaacgtgattctgatcttgatggttcccttgtatggttgcgttcaggcatat
tggattccccttcagatcaaaaccgccatctgggctgttctctattattatatgaccggt
attggtatcacggccggttaccatcgcctctgggctcactgttcctattctgcaacgctc
cctttgagaatctatttggctgccgtcggtgggggtgccgtccagggctcagtcagatgg
tgggctcgcgatcaccgtgctcaccaccgttataccgataccgacaaggacccatactcg
gttcgcaagggcctcttgtactcccaccttggctggatggtgatgaaacagaacccaaag
cgtatcggccgcactgatatcactgatctcaatgaggatccagtcgttgtctggcagcac
aggaactacctcaaggtcgtcctcaccatgggtttgatctttcccaccattgtcagtggc
ctcggctggggagactggtggggtggtttcatctatgctggcatcctgcgagtctttttt
gtccagcaagccaccttctgcgtcaattccctggcccattatttgggagaacagcctttt
gatgaccgcaactctcctcgagaccatgttctgactgccttgatcaccatgggtgaaggc
tatcacaatttccatcacgagttcccctctgactaccgtaacgctatcgaatggcaccag
tatgatcctaccaagtggatcatttgggtatggaagcaagtcggcctcgcatacgacttg
aagcaattccgtgccaatgaaatcgagaaaggccgcattcaacaattgcaaaagaaaatc
gaccaaagacgtgctaaccttgactggggtgttcctctcgagcagctgcccgttatggaa
tgggatgagtacgtcgaacaggctaagaacggccgtggtctcattgctattgccggagtc
gtccatgacgttaccaatttcatcaaggatcatccaggaggcaaggccatgatcaactcc
ggcattggcaaagacgcaaccgccatgttcaatggcggtatctacaaccactccaatgcc
gctcacaacctcctgtcgacgatgcgtgttggtgttattcggggcggttgcgaagtcgag
atttggaagcgatcccagcgagaaaataaggacatcgagtccgcccgtgatgcctatggc
cagagaatcatccgggccggcgaacaggtgaccaaactccctgaaccagtaccaagcgcc
ggcgctgcataa

DBGET integrated database retrieval system