KEGG   Uncinocarpus reesii: UREG_02417Help
Entry
UREG_02417        CDS       T01132                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ure  Uncinocarpus reesii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UREG_02417
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    UREG_02417
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     UREG_02417
Lipid biosynthesis proteins [BR:ure01004]
 Desaturase
  First
   UREG_02417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MASQEAVAVESSKAPSTGNDNKKLHITDTPVTLSTWHKHVNWLNVILILMVPLYGCVQAY
WIPLQIKTAIWAVLYYYMTGIGITAGYHRLWAHCSYSATLPLRIYLAAVGGGAVQGSVRW
WARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITDLNEDPVVVWQH
RNYLKVVLTMGLIFPTIVSGLGWGDWWGGFIYAGILRVFFVQQATFCVNSLAHYLGEQPF
DDRNSPRDHVLTALITMGEGYHNFHHEFPSDYRNAIEWHQYDPTKWIIWVWKQVGLAYDL
KQFRANEIEKGRIQQLQKKIDQRRANLDWGVPLEQLPVMEWDEYVEQAKNGRGLIAIAGV
VHDVTNFIKDHPGGKAMINSGIGKDATAMFNGGIYNHSNAAHNLLSTMRVGVIRGGCEVE
IWKRSQRENKDIESARDAYGQRIIRAGEQVTKLPEPVPSAGAA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcaagaagccgtggctgtagagtcctccaaggctccctcgaccggaaatgac
aacaagaagcttcatatcacagataccccggtcacactgtccacctggcacaagcatgtc
aactggttaaacgtgattctgatcttgatggttcccttgtatggttgcgttcaggcatat
tggattccccttcagatcaaaaccgccatctgggctgttctctattattatatgaccggt
attggtatcacggccggttaccatcgcctctgggctcactgttcctattctgcaacgctc
cctttgagaatctatttggctgccgtcggtgggggtgccgtccagggctcagtcagatgg
tgggctcgcgatcaccgtgctcaccaccgttataccgataccgacaaggacccatactcg
gttcgcaagggcctcttgtactcccaccttggctggatggtgatgaaacagaacccaaag
cgtatcggccgcactgatatcactgatctcaatgaggatccagtcgttgtctggcagcac
aggaactacctcaaggtcgtcctcaccatgggtttgatctttcccaccattgtcagtggc
ctcggctggggagactggtggggtggtttcatctatgctggcatcctgcgagtctttttt
gtccagcaagccaccttctgcgtcaattccctggcccattatttgggagaacagcctttt
gatgaccgcaactctcctcgagaccatgttctgactgccttgatcaccatgggtgaaggc
tatcacaatttccatcacgagttcccctctgactaccgtaacgctatcgaatggcaccag
tatgatcctaccaagtggatcatttgggtatggaagcaagtcggcctcgcatacgacttg
aagcaattccgtgccaatgaaatcgagaaaggccgcattcaacaattgcaaaagaaaatc
gaccaaagacgtgctaaccttgactggggtgttcctctcgagcagctgcccgttatggaa
tgggatgagtacgtcgaacaggctaagaacggccgtggtctcattgctattgccggagtc
gtccatgacgttaccaatttcatcaaggatcatccaggaggcaaggccatgatcaactcc
ggcattggcaaagacgcaaccgccatgttcaatggcggtatctacaaccactccaatgcc
gctcacaacctcctgtcgacgatgcgtgttggtgttattcggggcggttgcgaagtcgag
atttggaagcgatcccagcgagaaaataaggacatcgagtccgcccgtgatgcctatggc
cagagaatcatccgggccggcgaacaggtgaccaaactccctgaaccagtaccaagcgcc
ggcgctgcataa

DBGET integrated database retrieval system