KEGG   Uncinocarpus reesii: UREG_02458Help
Entry
UREG_02458        CDS       T01132                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     UREG_02458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 388 aa AA seqDB search
MAAAARTLTRAFARATPATSSAKSSVTRSSLRFTTPAYAFRASSRRGYSSGAEGKKSPSG
LLWSLAAVAAGGAGAFYYLGGNQLSNSAKPTVITDPTKEDFQKVYDEIARLLIEKDDYDD
GSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKRTF
AVAFTNSRNFPSLEKFPWITYSDLWTLAGACAIQELGGPTIPWRPGRKDSDMSACTPDGR
LPDASKDQKHIRAIFGRMGFDDREMVALSGAHALGRAHSDRSGYDGPWDFSPTVFTNDFF
KLLLDEKWVQRKWNGPKQFTDNSTKTLMMLPTDMALVKDKEFKKHVERYAKDSDVFFKEF
SEVFVKLLELGVPFASKAEDRYVFKASE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcagcacgcaccctcacgagagcttttgctcgagctacccccgcgacctct
tccgcaaagtcctcggtaacacgtagctctctccgcttcaccactcccgcctacgctttc
cgcgcgtcttcgcgtcgaggatactcttccggcgctgaaggcaagaagtcgccgtccggg
ctcctttggtctctcgctgctgttgctgctggtggtgctggtgctttctactatttgggc
ggtaaccagctgtccaactcggcaaagccgaccgttatcaccgacccaaccaaggaggac
ttccagaaagtttatgacgaaatcgcacgtcttctcattgagaaggatgactatgatgat
ggaagctatggaccggtgcttgttcgtttggcgtggcatgctagcggtacctacgacaag
gaaaccgggactggaggaagcaacggcgctaccatgcgtttcgctcccgagtcggatcac
ggagccaatgctggcttgaaggccgcgagagatttccttgagcctgttaaacggacattt
gcggttgcatttactaatagtcgcaatttcccctctttagagaaattcccctggattacc
tattccgatctgtggacgcttgctggtgcctgtgccattcaagagcttggtggacctacc
atcccatggcgccccggccgtaaggattccgatatgtctgcctgcacgcccgatggccgc
cttcccgacgcgtccaaggaccagaagcacatcagagccattttcggccgcatgggtttc
gatgatcgcgagatggtcgcactttctggcgctcacgctcttggacgtgcccactctgac
cgatctggatatgacggaccctgggacttcagccctacggttttcaccaatgacttcttc
aagctccttcttgatgagaagtgggttcagagaaagtggaacggccccaagcagttcacc
gacaacagcaccaagaccttgatgatgctgccaaccgatatggctttggtgaaggacaaa
gaattcaagaagcacgttgaacgatacgccaaggacagcgatgtcttcttcaaggagttc
tcggaagtgtttgtcaagcttctcgagcttggcgtgcctttcgcctccaaggctgaagac
cgctatgttttcaaggccagcgaatag

DBGET integrated database retrieval system