KEGG   Uncinocarpus reesii: UREG_02479Help
Entry
UREG_02479        CDS       T01132                                 

Definition
lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ure  Uncinocarpus reesii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UREG_02479
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UREG_02479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 645 aa AA seqDB search
MKPDHFTFYISAAAGLLAGSALAKIIQIPPTDVVVRALPNAPDGYTPANVPCPPDRPSVR
SAATISHNESDWLKNRRKKTTAALTDFFGRVSIANFDAAEYIRNHADNTSALPNIGIAIS
GGGYRALMNGAGVVQAFDSRTAGSTDQGRLGGLLQSATYLSGLSGGGWMVGSLYLNNDTT
VSALAGGQEGSAWDFTRSILEGPSDGGLAILDTIEYYRQIERAVNGKRDAGYDVSITDYW
GRALSYQLIDAPQGGPSYTWSSISLSPSLQNGDMPMPILVADGRNPGEKLIGGNATVFEF
NPWEFGTFDPTIFGFVPVEYLGSRFQAGTLPSNETCVRGFDNAGYIMGTSSSLFNQFSLH
LDTVDIPNFIKDEIRKLLERIGDENNDIAEYRPNPFYHYSNDTSPFANVVSLPLVDGGED
LQNIPLHPLIQPERHVDVIFAVDSSADTEYNWPNGTALVATYERSMDPAGLANQTSFPAI
PDQNTFVNLGLNTRPTFFGCNSSNTTGPTPLVVYIPNYPYSAFSNVSTFTMEYTDNERDG
IIRNGYNVGTMGNATRQKDWPTCVGCAILSRSFERTGTSVPDACQQCFRNHCWDGTLNST
TPNTYAPNVSMSDVGAKNAAPGMHTSSKQSIVAASVAILVAVMFW
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgatcatttcactttttacatttccgcagcagccggactgcttgccggctcg
gccctggccaaaataatccagatacctccaacagatgtcgttgttcgagccctgcccaat
gctcctgatggctatactcccgcgaacgttccttgccctccagatcgccccagcgttcgc
agcgcagccaccatctctcacaacgaatctgactggttaaaaaacaggaggaagaagaca
acagctgccctgacggacttcttcggtcgcgtctctatcgccaattttgatgccgcagaa
tatattagaaatcatgcggacaatacttcagcgctcccgaacattggaatcgccatctct
ggtggaggctacagggcgttgatgaatggcgccggtgtagtgcaggcgtttgattctcga
actgctggatcgacagatcagggccggcttggtggccttttgcagtccgcgacgtacctg
tctggcttgagtggaggtgggtggatggttggttcgttgtacttaaacaacgatacaacc
gtatccgcattggctggtggtcaagaaggttcagcatgggatttcacccgttccatcctg
gagggtccgtcggatggtggattggctattttggatactatcgaatactacaggcagatc
gagcgtgccgtgaatggaaaaagagacgctgggtatgatgtttctatcacggattactgg
ggccgggctctctcgtatcagttgattgatgcaccgcaaggcggcccttcatacacgtgg
tcctcgatctcactgagcccgagtcttcaaaatggtgatatgccgatgccaatccttgtt
gccgatggcagaaacccaggggagaaacttatcggtgggaatgccacggtgtttgaattt
aacccctgggagtttggaacgtttgatcccactatatttggttttgttcctgttgaatat
cttggttcgagattccaggctggcactcttcccagcaatgaaacgtgcgttcgcgggttc
gataacgccggatacatcatgggcacatcttcgtcgctcttcaaccagttctctcttcat
ttggatacggttgatattccgaattttattaaagacgagattaggaaacttttggaaaga
attggtgacgagaataacgatatcgcagagtaccgacccaacccgttctatcactactca
aacgacacctctccgtttgccaatgttgtatcgctccctttagttgacggcggagaggat
ctgcagaacatccctcttcacccgctaattcaaccagagaggcacgtagacgtgatcttc
gcggttgactcttccgcggacaccgagtacaactggcctaacggaactgctctggtcgct
acctatgaacggagtatggacccagctgggcttgctaatcagacttcatttcccgcgatc
ccggaccaaaatacatttgtcaatctcggcctgaataccaggccaaccttcttcggctgc
aatagttccaacaccactggtcccaccccgctagtcgtctacattccaaactatccttac
agcgccttttccaatgtctccactttcaccatggaatacacagacaacgagcgcgacggg
atcatcaggaacggctataacgttggcaccatgggcaacgcaacacggcagaaggattgg
ccgacatgtgtcggatgtgctattctaagccgatcgtttgagcgcacgggaacttcggtt
cctgatgcctgccagcagtgcttccggaaccattgctgggatggaacgctcaatagcact
accccgaacacgtatgcccccaatgttagcatgtcagatgtgggagcgaaaaacgcggct
cccgggatgcatacttcaagtaagcaaagtatcgttgctgcgtctgtggccattttggtc
gccgtcatgttctggtga

DBGET integrated database retrieval system