KEGG   Uncinocarpus reesii: UREG_02486Help
Entry
UREG_02486        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_02486
Enzymes [BR:ure01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     UREG_02486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MDRSNKPAAIPVTSSLPQPSVTVADGNVVASLPSGESVVVNLFGATVTSWKLANGHELLF
LSEKAVLDGSKPIRGGIPLVFPVFGPPPKNHATSALPQHGFVRNSFWEFLGKSTSESESG
ASVKLDFGLSNSMLTDKFKNDWAYEFGLVYSVTLSKRSLETSLQVQNKGSKSFEFQTLLH
SYLGLRYGMIAHLRNPHL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctcaaacaagcctgccgcgatcccagtcacttcctcccttcctcagccctcc
gtcaccgtcgccgacggcaatgtggtggcctcgctgccgtccggggaatcggtggtagtg
aacctctttggggccacagtcacctcgtggaagcttgccaatggccatgagctgctgttc
ctgagcgaaaaggccgttttggatggatcgaaacctattcgtggtggaattccgctggtt
ttccctgtttttgggcctccgccgaagaatcatgccacatctgccctgccccaacatgga
tttgttcggaactcgttctgggaatttctcgggaagtctacatccgaatcggagagtgga
gctagcgtcaagcttgactttgggctctcgaactccatgttgactgataaatttaaaaat
gactgggcatacgaatttgggctggtttacagtgtcacattgagcaaacgaagcttggaa
acgtcgttgcaggttcagaacaaggggtcgaagtcgttcgaattccagacgttgctgcat
tcatatttagggttgaggtacggaatgattgcgcatctacggaatccccatctgtag

DBGET integrated database retrieval system