KEGG   Uncinocarpus reesii: UREG_02486Help
Entry
UREG_02486        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ure00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MDRSNKPAAIPVTSSLPQPSVTVADGNVVASLPSGESVVVNLFGATVTSWKLANGHELLF
LSEKAVLDGSKPIRGGIPLVFPVFGPPPKNHATSALPQHGFVRNSFWEFLGKSTSESESG
ASVKLDFGLSNSMLTDKFKNDWAYEFGLVYSVTLSKRSLETSLQVQNKGSKSFEFQTLLH
SYLGLRYGMIAHLRNPHL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctcaaacaagcctgccgcgatcccagtcacttcctcccttcctcagccctcc
gtcaccgtcgccgacggcaatgtggtggcctcgctgccgtccggggaatcggtggtagtg
aacctctttggggccacagtcacctcgtggaagcttgccaatggccatgagctgctgttc
ctgagcgaaaaggccgttttggatggatcgaaacctattcgtggtggaattccgctggtt
ttccctgtttttgggcctccgccgaagaatcatgccacatctgccctgccccaacatgga
tttgttcggaactcgttctgggaatttctcgggaagtctacatccgaatcggagagtgga
gctagcgtcaagcttgactttgggctctcgaactccatgttgactgataaatttaaaaat
gactgggcatacgaatttgggctggtttacagtgtcacattgagcaaacgaagcttggaa
acgtcgttgcaggttcagaacaaggggtcgaagtcgttcgaattccagacgttgctgcat
tcatatttagggttgaggtacggaatgattgcgcatctacggaatccccatctgtag

DBGET integrated database retrieval system