KEGG   Uncinocarpus reesii: UREG_02632Help
Entry
UREG_02632        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ure  Uncinocarpus reesii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    UREG_02632
  Replication and repair
   03420 Nucleotide excision repair
    UREG_02632
Transcription machinery [BR:ure03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     UREG_02632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
MAASSSRSLEYLESLPGTVFLKLYQQPSTALAIFRRMLPHLAKCFVMALLYLKDPLPAAE
LELWVKTESKRERDNALSILSRLHILSSTTTANHVRAFMVTNPFSSSLRQALTGGDKQQS
FGVISTTPDPQPMTIADLDDYARRQWEGVLGYMVGTNTLGIQRESVTLSKGVKSLLQACH
LVEVRDRRVEITKEGFAFVLQDVNTQVWHILVLYVENAEAIGMDSVEVLSFLFLLSSLEL
GQSYEKQHLSSTQLRTLADLTDFGIVYQHSPASEATRFYPTRLATTLTSDSMALASPMSV
HPSGRGNGHHS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcttcctcccgctccctggaatatctggagagcctcccagggaccgtattt
ctcaagctatatcaacaaccttcaactgcgctggcgatctttcgacggatgctgccccat
ctagcaaaatgctttgtgatggcgcttctctatttgaaagatccgctcccagcagctgag
cttgagttatgggtcaagacggagagcaagcgcgagagagacaacgctctatcgatcctg
agccgattacatatcctttcaagcacaaccactgcaaaccacgttcgagcgtttatggtt
acaaaccctttctcctcgtctctccggcaagctctcactggaggggataagcaacaatca
tttggagtgatatccactacgccagacccgcaaccaatgactatcgccgacctagacgac
tatgccaggcggcaatgggaaggagttcttggctacatggttgggacaaacacactgggt
attcaacgtgagagcgtgacgctcagcaagggagtcaaatcccttcttcaggcctgccat
ctggtcgaagtgcgggaccgcagagtagaaatcaccaaagaaggattcgccttcgttctc
caagatgttaatacgcaggtctggcacattctcgtgctctacgttgaaaacgccgaggct
atcggaatggatagcgtcgaagtgctctcattcctcttcctccttagcagtctagaactt
ggacagtcctacgaaaagcaacatttgagctcaacacaacttcgcactctcgccgacctc
actgatttcggaattgtttaccagcactccccagcttcggaagctactcgtttttaccct
acccgtctcgcaaccaccctcacatccgactccatggcccttgccagcccaatgtcagtc
catccgtcgggccgtggaaatgggcatcacagctga

DBGET integrated database retrieval system