KEGG   Uncinocarpus reesii: UREG_02642Help
Entry
UREG_02642        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UREG_02642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1100 aa AA seqDB search
MSPAEHAGSPGRQQQLTTNNGRDQLASSFNQLSLASPGAPNRSSPSRTPSQSYRSLDRIQ
PPRYESSSYRPPVPRRTPSINSLRDERRASTPSLKKRLSTASLRSVQNSNGVGSPRASTS
RRASSQFLTPSRTMMRPGSPSMSECPSPPPPLTAASVAADHFAKELALHQSTNLQSRAVV
VLQDSCFGHRYSRPRTSKVGLESIVERPERLHAAILGLAAAYVRMGKRWGHHRFAPHPDL
DLSRLPVPPFQIRKTTRTMPLNSPAVTHVHGVKWMAELKTMCDAAESRLAAGGKELVRPT
SSGSDASRSASKLHEGDLYLCPESLNAFEGALGGVCEAVDAVFENDATRRAFVCVRPPGH
HCSSDYPSGFCWLNNVHVGIAHASMTHGLTHAAIIDFDLHHGDGSQTIAWEQNQKAISGH
RNALPHQKVKIGYFSLHDINSYPCESGDEEKVMNASVCIDNAHGQSVWNVHLESWNDATE
FWQLYNTKYTVLLDKARGFLRSQAQQISASTSYVRPKAAIFISAGFDASEWEGVGMQRHQ
VNVPTDFYAKFTLDIIRLAEEEDLAVDGRVISVLEGGYSDRALTSGVFSHISALAVTQNS
VDHTENNSRLISEMFNRLDLEDQSGQGSSSGLTEEPVAFDTTWWSVPMLEELEAISQRPP
PPPIRKSRDKGQPNFLAHTQASAAKAVAPVKDRGALFSHDGTPDEPYSVPEADWALATVE
LSKAIIPTDRQTLSLKYADLKGENGRTKRERHSLTSSTELESVSERGHMQLRERKPKASV
FPELQPGNSRPARSTRRTTIASSSDLPDPTLLETPIEALEEAQVPPPPLSRKLSVTSSAV
SATSKDSTTRKPREAPNRPVSRTQAPTSRPATSLVLNVPKQRAATSGRTPGKNGRSLSKR
APPPDEKLDNAIESPSSTRAISLNEGIDTISSGVRKIQLRLKVPTPEEHAAREAARIAEE
RSRAASRPPKKSSVARAQKQYPGKPAAKSSRTMTPAAASKVELKPVTIDPPTIPLPAESN
PISPTEILVSNTALSPEEQRGTNNQSFPSPPLTPLSPFTQPQKTVQSAPPTTYTKESLPV
FTSTSAIPFGPPPVKDSGSY
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccggcagagcacgctggatcgccagggcgacagcagcagctcacaacaaacaat
gggcgtgaccagctggcgagctccttcaaccagctctcgctcgcatcaccaggtgctccg
aatcggtcttccccctcgcgaacgccgtcccaatcgtatcgttcccttgatagaatccaa
ccaccgcgctatgaatcgtcctcgtatcgaccccccgtgcctcgacgaacaccaagcata
aactctctgagagacgagaggcgggcgtcgactccctctttaaagaaacgattatctacc
gcttctctacgctccgttcagaactcaaacggtgttggctctccgcgcgcgagcacctcc
aggcgagcttcctcccaattcctcaccccttcgagaacaatgatgcgacccggttcgcct
tcgatgtcggaatgtccgtcgccccctcctcccctcactgccgcgtcagtcgctgcggat
catttcgcgaaagaacttgcgctccatcagtctacaaatctacagtcgagagccgtcgtg
gtactccaggattcgtgcttcggacataggtattcacgcccaaggacttccaaggtggga
ttggagtctatagttgagcggccagagcggctacacgctgcaattttggggttggcagct
gcatatgttcggatggggaagcgatggggccatcaccggtttgcgccgcaccctgatctc
gatttaagtcggttgccagtgccgccctttcaaattcgcaagacgacacgaactatgccg
ttgaactctcccgcagttacccatgtgcacggagtcaagtggatggcggaattgaaaacg
atgtgtgatgcggcagaatctcgcttggcagcgggtgggaaggagcttgtccgcccgacc
agctcagggagcgatgcctcccgttccgcctctaaattgcatgagggtgatttatactta
tgtccagagtctttaaacgcctttgaaggggcattaggaggcgtatgtgaagccgtcgat
gctgttttcgaaaacgacgcaacacggcgcgcgttcgtctgtgttcgtccaccgggccac
cattgttcttcggattatccttctggattttgctggttgaataatgtgcatgtcggtatt
gcccacgcttcgatgacccacggcctaacgcacgctgcaatcattgactttgatctgcat
cacggtgatggatcccagaccattgcctgggagcagaaccagaaagcaatatcgggacat
agaaatgccctgccacatcaaaaagtcaaaatcggctattttagtttgcatgatatcaac
tcatacccttgtgaaagtggtgatgaagagaaagtcatgaacgccagcgtctgcattgac
aatgctcacggccaatccgtctggaatgtgcaccttgaatcatggaacgatgctacggag
ttttggcagttgtataatacgaagtacacggttcttctggacaaggctcgtggctttttg
cgatcgcaggctcagcaaataagtgcttcgacaagttatgtccgaccaaaggctgcgatt
ttcatctccgcagggttcgacgccagtgaatgggaaggtgttggcatgcaaaggcatcaa
gtcaatgtccctacagatttctacgctaaatttacgttagatatcatccgactcgccgag
gaagaggatctagcagtggacgggagagtcattagtgttctcgaaggcggatatagtgac
cgggcactaactagtggagttttcagccatatttcagctcttgcagttacgcaaaactcg
gttgaccacacagaaaataatagccgcctaatatctgagatgttcaatcgccttgatctt
gaggatcagagtggacagggctcaagctctgggttgactgaggagcctgtagccttcgac
acgacgtggtggagcgtcccgatgctggaagagttggaagcgatttcccagcgcccgcct
ccgccacctattcgcaagtctcgcgataagggacagccaaatttcttagcacatacccaa
gcgtcggcggcgaaagcagttgcgccggtcaaggatcggggagctctgttctctcacgat
ggtactccagacgaaccttactcggttcccgaagccgattgggcattggcaacggttgaa
ttatccaaagccattatacccactgaccggcagactttaagcctgaagtatgccgattta
aagggggaaaatggccgtactaaacgagaacgccattcactgacaagctctaccgaactc
gaaagtgtttccgaacgcggtcacatgcaacttcgggaaagaaagcccaaagcatcagta
ttcccagagttgcaacctggaaattctagaccggcccgcagcactcgccggactactata
gcatcatctagcgacttacccgatcccacccttctcgaaacaccaattgaagctcttgag
gaagctcaggtgccacctccaccactttcccgaaagctcagtgtaacctcgagcgcggtc
agtgcgacatctaaagacagcaccacccgaaagcctcgcgaggctccaaatcgccctgtt
agcagaacacaagccccaacctcgaggcctgcaacatctctggttttgaatgtcccgaag
caaagggcggctacgtcgggtagaacaccaggaaaaaatgggcggtccctttcaaaaagg
gcacctccgccagatgaaaagcttgataatgctatcgaaagccctagctccacccgtgca
atctccctgaatgaaggcattgacaccatttcgagcggcgtgaggaaaatacaacttagg
ctgaaggtccctacccctgaagagcatgctgctcgagaggcagcaagaattgcagaagaa
cggagtagggccgcaagtagaccgccaaagaagagttctgtggcacgagcacaaaaacaa
tacccaggcaagccagcggcaaagtcttcccgtacgatgacacctgcagcggcttcaaag
gttgagttgaagcctgttactatcgatccaccgacaatccctctcccggcggagtctaac
ccgatttcgccgactgagatattggtctcaaatactgctctaagccctgaagagcagcga
ggcaccaacaaccagtcttttccttctccgcctctaacaccactttcaccatttacccaa
ccgcaaaagacggttcaatcagctcccccaacgacttacactaaggaaagccttcccgtt
ttcacttcaacttctgccatcccatttggccctccacccgtcaaggattctggttcatat
tag

DBGET integrated database retrieval system