KEGG   Uncinocarpus reesii: UREG_02793Help
Entry
UREG_02793        CDS       T01132                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ure01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ure01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ure00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ure00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ure00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ure00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ure00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 771 aa AA seqDB search
MASSAPSGHLTVPLAKRRRIAVLTSGGDAPGMNGVVRAVIRMSIHCKCEAYAIHEGYEGL
VQGGDLIRRMHWEDVRGWLSRGGTLIGSARCKSFMQRAGRLQAARNMVIRGIDALIVCGG
DGSLTGADVFRSEWPGLLDELVQNGDLTANQVAPYKTLNIVGLVGSIDNDMSTTDATIGC
YSSLHRICEAVDEVFDTAASHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDG
WEDDILKLDTRVTVLGHTQRGGAACAYDRWLATLQGTEAVRAVLEATPDSPSPIITIREN
KIERGSLIEAVEATKRVAKCVDEKGFEEAMQLRDSEFKAYHRAYINTTTPHHPKMLLAPE
KRMRIAIIHVGAPAGGMNPATRAAVAYCIARGHTPVAIYNGFPGLCRHHADKPLGSVREV
DWLESDSWVNEGGSEIGTNRGLPSEDMPTTAHCFELYKFDALFIIGGFEAFTAASQLRQA
RKDYASLRIPIVVLPATISNNVPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIE
TQGGRSGYIAVMAGLAVGAYAVYIPEEGIDIKMLARDIEYLRHNFATDRGASHAGKVILR
NEKASGTYTTQVIADMIKEEAKGRFESRAAVPGHFQQGGKPSPMDRIRALRLALRCIQHL
ESFAGRSGEEIAADEMSSVVIGIRGSEVVFGPMSGEDGLEATDTDWEHRRPRNEFWMKLR
HLVDTLSGRPADSKEGKFQLSDDEGWESGGTSDPCHFAATPKIRPRELPLR
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctgctccctccggacacttgacggtccccctggccaagcggcgccgcatt
gccgttctcaccagtggcggagacgctcctggtatgaacggtgtcgtgcgtgcggtgatc
cggatgtcgattcattgcaagtgcgaagcgtacgctatccatgaaggctacgaaggcctt
gtccagggcggcgatttgatccgacggatgcattgggaagacgttcgcggttggttgtct
cgcggcggtacgctcatcggttcagctcgatgcaagtcctttatgcaaagagcaggccgc
ctgcaagccgcaaggaacatggtcataagggggatcgacgcccttattgtttgtggagga
gacggcagtttgaccggcgcagacgtctttcgctccgaatggcctggcttgctcgatgag
cttgtccagaacggtgaccttaccgccaaccaagttgcaccatataagaccttgaacatc
gtgggcttagtgggctcgattgacaatgacatgtcgaccacggatgctactatcgggtgc
tattcctcattgcatcgtatctgcgaggccgttgacgaagttttcgacaccgccgcttcc
catcaacgtggttttgtcattgaggtgatgggaagacattgcggctggcttgccctcatg
tctgccattagtacaggtgctgactggctatttatccccgagatgcctccgcgggacggt
tgggaagatgacatactcaagcttgacacccgcgtcacagtcctgggacatacgcagagg
ggtggcgccgcgtgtgcttacgatagatggctcgcaaccctccagggaactgaagctgtg
agagccgtgctcgaagcaacgcctgattctccatcccctatcatcacaattcgcgagaac
aaaattgaaaggggctccttaatagaagctgttgaggctactaagagagtcgcaaaatgt
gtagacgaaaagggctttgaggaggctatgcagcttcgagattcagaatttaaagcttac
cacagggcttacatcaacacgaccactccgcatcatcccaagatgctgcttgccccagag
aagcgaatgcgcattgcgattattcacgttggtgccccggccggcggcatgaatcctgca
actagagcggcagtggcctattgcattgctcgaggacatactcccgttgccatttataac
gggttccctgggttgtgccgtcatcatgctgataagccactgggctccgttcgcgaggta
gactggttggagtcagattcctgggtaaacgagggtggctccgagattgggacgaatcga
ggtcttccctctgaagatatgccaacgaccgcacattgcttcgagctatacaaattcgac
gctctgtttataataggagggttcgaagcctttactgcagcaagccagcttcgacaagca
agaaaagattacgcctcgttgagaatccccattgtggtgctccctgctactatttcaaat
aatgttcctggcacagaatactcactgggcagcgatacttgcctcaatacactggtgaat
ttttgcgacgtgatccggcaatccgcttcttcttcgcgtcgccgagtattcgtgattgag
actcaaggcggccgttctgggtatatcgctgtgatggctggattggcagtgggagcttat
gcagtctacatccccgaggaaggaatcgatatcaaaatgctcgctcgcgacatcgaatac
cttcgccacaactttgcgaccgaccggggcgcgagtcatgcgggtaaggtcattcttcgc
aacgagaaagcttctggcacgtataccacacaagtcatcgcggatatgatcaaagaagag
gcgaagggccgtttcgagtctcgcgcagctgtgcctgggcatttccaacagggcggaaaa
ccatcaccgatggaccggatccgtgcactccgtcttgcgctccgctgcatccagcatctc
gaatcattcgcggggcgcagcggtgaagaaattgcagctgatgagatgtcgagcgttgtg
atcggtatccgaggcagtgaggttgtctttggcccaatgtccggcgaggatggcctggag
gcgacggatactgactgggagcatcgacgtccacgaaacgaattctggatgaagttgcga
catctggtcgatacgctcagcggacggcctgcggacagcaaggagggcaagttccaactg
tccgatgacgagggctgggagtctggcggcacgtccgacccgtgtcattttgcggccact
cccaagatcaggcctagagagctacctctcagatag

DBGET integrated database retrieval system