KEGG   Uncinocarpus reesii: UREG_02803Help
Entry
UREG_02803        CDS       T01132                                 

Definition
profilin-2
Orthology
K05759  
profilin
Organism
ure  Uncinocarpus reesii
Brite
Exosome [BR:ure04147]
 Exosomal proteins
  Proteins found in most exosomes
   UREG_02803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MSWQGIEVPILSSELQPIQPCHFNSLSQHAATPRDKVSPAEMKIIVDSFKPTSRDDEVKE
VQANGFFVAGEKYVALRSDDSRLYGKKGKEGIVIVKTKKALLIAHYPETVQPGAATNTVE
TLGDYLSGLGY
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaaggtatcgaggtcccgatccttagttccgagctgcagcccatccaaccc
tgccactttaactctctgtcacaacatgctgcaacgcccagggacaaagtctctccggca
gagatgaaaattatcgtcgattccttcaagcctacttctcgtgatgatgaagtgaaggag
gtgcaggctaacgggtttttcgtggccggggagaaatacgttgctttacgatcagacgac
tcgcgcctttatggcaagaagggtaaagaaggcattgtgattgtaaaaacgaaaaaggca
ctactcatcgcacattacccggaaaccgtgcagcccggcgccgcgaccaacaccgtcgag
accctcggcgattatctcagcggattaggctactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system