KEGG   Uncinocarpus reesii: UREG_02874Help
Entry
UREG_02874        CDS       T01132                                 

Definition
similar to ubiquitin thiolesterase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UREG_02874
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   UREG_02874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MAEDAGGWSTIESDEGVFTSLVENLGVKNVQFEELISLDTDTIRSLSPVYGVIFLFKWVR
GQAPQTDAPEYGAYDPSATENGLFFAAQTIQNACGTQAILSVILNQDGPTPADPTGTGID
IGPELRDFKEFTTGFPPDLRGEALSNSAQIRDAHNAFARASPFVDETSRPPVSDEDAELY
HFIAYTPFNGVLYELDGLQPFPISHGECSAADFPEKVIDAVRIRMTRYADSEIRFNLMAV
VKDPRIRAAEIGDVETLEREERKRRGWAWENALRRWNFVGFIGEVLKGVVGMKVEKGEGE
YEKWVKDATDATAKKANMRRERGNGGEE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatgctggtggatggagcactattgagtctgacgagggagtattcacttca
ttagtggagaatctgggtgtgaaaaacgttcaatttgaagagctcatatctcttgacacc
gacacaataaggtcgctaagccctgtgtacggtgtcatattcctcttcaaatgggtaaga
ggccaagcaccccagaccgatgccccggaatatggcgcctatgacccctccgccacagaa
aacggcctcttcttcgctgcgcaaacgattcaaaacgcctgcggcacccaagcgatcctc
tccgtaattctaaaccaagacggtcccacaccggccgacccaacgggcacggggatcgat
attgggcctgaactccgcgatttcaaggaattcacaaccggattcccgcccgatctgcgc
ggcgaggcgttgagtaattccgcccagatccgcgatgcgcacaatgcattcgcgcgcgcc
tcgccgtttgtcgatgagacgtcgcggccccctgtttccgacgaagatgcggagctatac
cacttcatcgcatacacgccattcaacggggtgctctatgagctggatggattacagccg
tttccgatcagccacggagaatgcagcgcggcggattttccggagaaggtaatcgacgct
gtgcggatacgcatgacgcgatatgcggatagcgagatccggtttaatttgatggcggtg
gtcaaggacccgcgcatccgcgcggcggagattggggacgttgaaacgctggagagggaa
gagaggaaacggcggggttgggcgtgggagaatgccctgaggaggtggaactttgtggga
ttcatcggggaagtgctgaagggagtggttggcatgaaggtggagaagggtgagggcgag
tatgagaagtgggtgaaggacgcgacggatgcgacggcgaagaaggcgaatatgcgcagg
gaaaggggcaatgggggggaggaatag

DBGET integrated database retrieval system