KEGG   Uncinocarpus reesii: UREG_02881Help
Entry
UREG_02881        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ure  Uncinocarpus reesii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ure00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 632 aa AA seqDB search
MAGSKLDVSGPHGEAESPSARTPDETRPGQSPLFLQVFSWLRTERAKLAARKLKESDRPS
SERSDSTNVDSWAGEMELSLDQLERILAQYSNIRSKSAMAQKQRIKGLRRGSHSDSDYAD
SDQAVPSADVVLDNSKTLLYVGGEADSNVDALAPKPFPKDRENWLKFKSEIVRLAHTLGI
KGWRRVPLESGGEVEVIRLSGALTNAVYVISPPKNLPLASRSDSSLNSTRRKPPPKLLLR
VYGPQAEHLIDRERELQILRRLRKKNIGPRVLGTFANGRFEQYFNAKPLTCHELRIPETW
KQIAKRMRELHDGIDLLPEERESGPALWQNWDKWVDRCEKVTTWLDQEILSEKKASNVPE
ERWRQRGFVCCVPWRTFRATVDRYRKWLSEHFGGDFELSKRLVFAHNDTQYGNLLRLQPS
EESPLLLPANEHKQLIVIDFEYASANMRGVEFANHFTPLIRPAYASSPRAPPFLLDSYIP
GLNPPLTDPESRDPVVEAEVQQLLRETRLWRVANSAQWVAWGIVQAHVPGINKVLSGQGS
ATNATDTTTANPISGKTAASVEQRTPINLALNHDQVKQEFEAEEAADDFDYLAYAQDRAL
FFWSDLLALGFIKEEELPAEMVKQIKKRIINY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggccggttcaaaactagacgtttccggtccgcatggagaggctgagagcccgagcgcg
aggactcctgacgaaactcgccccggccagagcccgcttttcttgcaagttttcagctgg
ttgcgcactgaaagggcaaagctagcagcacggaaactgaaggaaagtgacaggccctct
tctgaaagatcagactcgacaaatgtcgactcttgggccggcgagatggagttgtctctg
gaccaactagaacggattctcgcgcaatactccaacattcggtctaaaagcgcaatggca
cagaagcaacgtattaaagggctacggcggggatcgcattctgactctgactatgcggac
agcgaccaggcagtacccagcgcagatgtggttttagacaattccaagaccctcctctat
gtcggcggtgaagcggatagcaatgtcgacgctctagcgcctaaacctttccccaaagat
cgcgaaaactggctcaagttcaaatctgagattgtccgcttggctcatacattgggtatc
aaaggctggagaagggtgccgctagaatctgggggtgaagtggaagtaatccgccttagc
ggagcattaaccaatgctgtttatgttatttcgcctcccaaaaacctcccactggcttca
agatcagattcatcactgaattctactcggaggaaacccccaccaaaacttctgcttcgc
gtctatggcccacaagccgaacaccttatcgacagagagcgtgaacttcaaatcctccgt
cgtctacgaaagaagaacattgggcctcgtgttttggggacattcgccaacggccgtttc
gaacaatacttcaacgccaaacctcttacttgccatgaactgcgtattcccgaaacgtgg
aaacagattgccaagcgtatgcgagaattgcatgatggtattgatctgctcccagaagaa
cgggaaagcggacctgccttatggcaaaattgggataaatgggtcgaccgttgcgagaag
gttactacctggttagatcaagaaatcttatcggaaaagaaagcctcaaatgttcctgag
gaacgttggaggcagcgtggtttcgtatgctgcgttccctggcggacttttcgagccacg
gttgataggtatcggaaatggctgagtgagcatttcggtggtgactttgaactttcgaaa
cggctagtatttgcacataacgatacgcaatacggtaaccttctccgcttacagcctagc
gaagagtcgcctttattactccccgcgaatgagcataagcagttgattgtcatagatttc
gaatacgcgtctgccaacatgcgtggtgtcgaattcgcgaaccactttacaccgttgatc
cgaccagcatatgccagtagcccgcgtgcgcccccgttcctgcttgatagttatattcca
gggctaaacccacctctcacggatcccgagagtcgtgatccagtcgtagaggctgaagtg
caacagctacttcgagagacacggctgtggcgggtagcgaactcagcgcaatgggtggca
tgggggattgtgcaagcccatgttcctggtataaacaaggtactttctggacaaggcagc
gcaacaaacgctacagatactacaaccgcgaatcctatctctggaaaaacggcagcatcc
gtcgagcaacgaacaccaattaatttagcgctcaaccacgatcaggtcaagcaagagttt
gaagccgaagaagcggcggatgactttgactatcttgcctatgcacaggatagggcgttg
ttcttttggtcagatttgctggcgttggggttcataaaagaggaagaattgccagcagag
atggtgaagcaaatcaagaaaagaattatcaactattag

DBGET integrated database retrieval system