KEGG   Uncinocarpus reesii: UREG_02928Help
Entry
UREG_02928        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ure01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ure00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ure00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ure00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MAVGVTDKTPEVRHEIPKTCKAGVVYNEGPDFVLKVEDVPVPEPGPDEVLIKLNITGLCY
SDIHFMLGDLGGPTMGGNNVRSPGHEGAGVVVQVGSNVKNWKVGDRAGVKPMWNTCGSCE
LCWGDKETYCPKSISTGLQVAGTYQQYITSPASYTTPIPDGVPDEIAAPIMCSASTVLRS
LEESKLRPGEWAVFPGGGGGVGIQGVQLAKAMGIRAIAIDTGDAKRELCLKMGAEHFVDF
KESKNVANEIVELCDGIGAHAVFVTAPQAYRDAISFLGGRVGAKVMCIGLPSASEYVFGA
HPAQFVFKNMSVVGTLVGSMKDTARALDFAKRGLLKPIYEKWPIERMPEAVEKLRRGQVA
GRYVVDFNA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggagttacggacaagacaccggaagttcgccatgaaatccccaagacgtgt
aaggcaggggttgtctataacgaagggcccgatttcgtcttgaaggtggaagatgtccca
gttccggagcccggaccggatgaggttctcatcaaattaaatatcaccggcctctgctac
tccgatatccatttcatgcttggagacctgggcgggcctactatgggcgggaacaacgta
cggtcgccgggccatgaaggtgccggtgtcgtcgttcaggtaggatccaacgtgaagaac
tggaaggtcggtgatagggcaggcgtaaagccaatgtggaatacatgcggttcctgcgaa
ctgtgctggggcgacaaggagacttattgtcccaaatctatctccacgggtctacaggtt
gctggaacatatcaacagtatatcacaagcccagcgagttacacgacaccaattcctgat
ggcgtccctgacgagattgcggcgcctatcatgtgcagcgcctcaacagtccttcgcagc
ctcgaggagtccaaactacggcccggggaatgggcggtcttcccaggaggaggaggcggt
gtcggcatccagggtgttcaactcgccaaagccatggggatacgggctatcgcgatcgat
actggagatgcgaagagagagctgtgtttgaaaatgggggcagaacactttgtggatttc
aaggagagtaaaaacgtggccaacgaaatcgtggaactctgcgacggaattggtgcccat
gcggtctttgtgacagcgcctcaagcatacagggatgccatctcctttctcggtggtcgg
gttggggccaaagttatgtgtatcgggctgccatcggcaagcgaatacgtgtttggcgct
catcctgcgcaatttgttttcaaaaacatgtctgtcgtgggcacgctggttgggtcgatg
aaagacactgcccgggccctcgattttgccaagcgggggctcctcaaaccgatctatgag
aaatggccgatagaaaggatgccagaagcagttgagaagctgcggcgcggacaagtcgcg
gggcgatatgttgttgattttaacgcatag

DBGET integrated database retrieval system