KEGG   Uncinocarpus reesii: UREG_02928Help
Entry
UREG_02928        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00010  Glycolysis / Gluconeogenesis
ure00071  Fatty acid degradation
ure00350  Tyrosine metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_02928
  Lipid metabolism
   00071 Fatty acid degradation
    UREG_02928
  Amino acid metabolism
   00350 Tyrosine metabolism
    UREG_02928
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UREG_02928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 8443544
NCBI-ProteinID: XP_002543412
UniProt: C4JIR7
AA seq 369 aa AA seqDB search
MAVGVTDKTPEVRHEIPKTCKAGVVYNEGPDFVLKVEDVPVPEPGPDEVLIKLNITGLCY
SDIHFMLGDLGGPTMGGNNVRSPGHEGAGVVVQVGSNVKNWKVGDRAGVKPMWNTCGSCE
LCWGDKETYCPKSISTGLQVAGTYQQYITSPASYTTPIPDGVPDEIAAPIMCSASTVLRS
LEESKLRPGEWAVFPGGGGGVGIQGVQLAKAMGIRAIAIDTGDAKRELCLKMGAEHFVDF
KESKNVANEIVELCDGIGAHAVFVTAPQAYRDAISFLGGRVGAKVMCIGLPSASEYVFGA
HPAQFVFKNMSVVGTLVGSMKDTARALDFAKRGLLKPIYEKWPIERMPEAVEKLRRGQVA
GRYVVDFNA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggagttacggacaagacaccggaagttcgccatgaaatccccaagacgtgt
aaggcaggggttgtctataacgaagggcccgatttcgtcttgaaggtggaagatgtccca
gttccggagcccggaccggatgaggttctcatcaaattaaatatcaccggcctctgctac
tccgatatccatttcatgcttggagacctgggcgggcctactatgggcgggaacaacgta
cggtcgccgggccatgaaggtgccggtgtcgtcgttcaggtaggatccaacgtgaagaac
tggaaggtcggtgatagggcaggcgtaaagccaatgtggaatacatgcggttcctgcgaa
ctgtgctggggcgacaaggagacttattgtcccaaatctatctccacgggtctacaggtt
gctggaacatatcaacagtatatcacaagcccagcgagttacacgacaccaattcctgat
ggcgtccctgacgagattgcggcgcctatcatgtgcagcgcctcaacagtccttcgcagc
ctcgaggagtccaaactacggcccggggaatgggcggtcttcccaggaggaggaggcggt
gtcggcatccagggtgttcaactcgccaaagccatggggatacgggctatcgcgatcgat
actggagatgcgaagagagagctgtgtttgaaaatgggggcagaacactttgtggatttc
aaggagagtaaaaacgtggccaacgaaatcgtggaactctgcgacggaattggtgcccat
gcggtctttgtgacagcgcctcaagcatacagggatgccatctcctttctcggtggtcgg
gttggggccaaagttatgtgtatcgggctgccatcggcaagcgaatacgtgtttggcgct
catcctgcgcaatttgttttcaaaaacatgtctgtcgtgggcacgctggttgggtcgatg
aaagacactgcccgggccctcgattttgccaagcgggggctcctcaaaccgatctatgag
aaatggccgatagaaaggatgccagaagcagttgagaagctgcggcgcggacaagtcgcg
gggcgatatgttgttgattttaacgcatag

DBGET integrated database retrieval system