KEGG   Uncinocarpus reesii: UREG_02935Help
Entry
UREG_02935        CDS       T01132                                 

Definition
serine/threonine-protein kinase AFC2
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     UREG_02935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 661 aa AA seqDB search
MSTPSTATATHPTNHPHYRYPHQTFHANTTPYPAAPAVGAARAANYHYPSVNHPAALSSA
SAASKSSQAQPPMATYQTSAILPTAQSRRRKPNWNEFYKNGVPKEIIVIDDDDEDPQNVS
SNNSVYTSSTVKPSSLASYGNGVAAPPATKKRRTGAETTYDVAYHDPASFPVAVQPYAEG
SSGPSLSTDRTASLHTTAPTSLGSHGSASTNGVYYEDAAIGQKRKRVVTRKAARDEQKRR
ELEIAGDAFDNYVPPPRPPIKAKDVYVPVIRDPHFTKHSKVDDDDGHYIVNPDTNLTDRY
TIIKLLGQGTFGKVVEAFDRQKKTRCAVKIIRSVQKYRDASRIELRVLSTLASNDTTNRN
KCIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQSFARQLFTSVAFLHDV
NLIHTDLKPENILLVNSTYQTFTYNRTIPSSSHNTSRTARQRRVLLDSEIRLIDFGSATF
NDEYHSSVVSTRHYRAPEIILNLGWSYPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMM
ESVCGSRIDTKLVRQVMQARSGGNPAAKYFNRTRLDYPNQETPRASRKYVKGMRQLQDFI
PANTSFNKQFLDLLRRIFVYDPLARISAKDALKHPWFKESIIDDGTEAVRIGQMRDRGSR
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccctcaacagccactgccacccatcccacaaaccatccacactaccgctat
cctcaccaaacctttcacgccaacactacgccgtatcctgcggcccctgcggtgggagca
gcccgcgctgcaaactaccactatccctctgtgaatcaccccgccgctctgtcctccgcc
tccgctgcttccaagtcctcccaggctcagccgcccatggcaacgtatcagacatctgcc
atcctccccacggctcagagtcgccggagaaagcccaactggaacgagttctacaaaaac
ggagtccccaaggagatcatcgtcatcgatgacgacgatgaagaccctcaaaacgtctcc
tcgaacaactccgtctatacctcctccacggtgaagccctcttcactggcctcctacggt
aacggcgtggccgcaccaccggcaacgaagaaaaggcgcaccggtgcagagacaacatat
gacgttgcatatcatgaccccgcgtccttccccgtggccgtgcagccgtatgcggaaggc
tcctcggggccttcgctctcgacagatcgaacggcgtcgctccacaccacagcgccgaca
tccctggggtctcatggcagtgcatcgaccaatggcgtgtactacgaagatgcggctatt
ggacaaaagcgaaagcgagtcgtcacacgcaaggccgctcgcgatgaacagaaacgacgg
gaattggaaatcgcaggcgatgcgttcgacaattacgttccgccgccgcgtcctccgatc
aaagccaaagacgtctatgtgcccgtgatccgcgatccacacttcaccaagcattcaaaa
gttgatgatgatgacggtcattatatcgtgaacccagacacgaatttgactgatcgatac
accatcatcaagttgcttggccaaggaacttttggaaaagtcgtcgaagcgtttgatagg
caaaagaagacccgttgtgcggtgaagattattcggtctgttcaaaaatatcgcgacgct
tcccgcattgagctgcgggtcctgtccacgttggcgtcgaacgacacgaccaaccgcaac
aagtgcatccatctccgagattgtttcgatttccgaaatcacatttgtatcgtgactgat
ctacttggccaaagtgtctttgatttcctcaagggcaacggatttgtgcctttcccaagt
agccaaatccagagttttgcccgccagttattcaccagtgttgccttcctccacgatgtc
aaccttatccataccgacttgaaacccgagaatatcctcttggtcaacagcacttaccag
acctttacctacaaccgcacaatcccctcttcctcccacaacaccagccggactgcccgt
cagcgacgggtgctgctagacagcgaaattagattgatcgatttcggctctgctaccttc
aatgacgaatatcactcgtccgtggtctcgacccgtcattaccgtgccccggaaatcatc
ctgaatcttggatggagctatccttgcgatatttggagtatcggctgtattctagttgaa
ttcttcaccggcgatgccctcttccagacccatgataatctagagcatcttgcaatgatg
gagagcgtctgtggaagcaggattgatacaaagttggtgagacaagttatgcaagcacgg
agcggtgggaatcctgcggccaagtatttcaaccggactcggctggattatccaaaccag
gaaactcctcgagcatctcgcaaatacgtaaagggcatgagacagttgcaggacttcatt
cccgccaatacttccttcaacaagcagtttcttgatcttctgcgtcggatatttgtatac
gatccacttgcacgaatctcagccaaagatgctcttaaacacccttggttcaaggagtca
attatcgatgacggtaccgaggccgttcgcatcggccagatgcgagacagagggagccgt
tcatga

DBGET integrated database retrieval system