KEGG   Uncinocarpus reesii: UREG_03064Help
Entry
UREG_03064        CDS       T01132                                 

Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ure  Uncinocarpus reesii
Brite
Protein phosphatases and associated proteins [BR:ure01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     UREG_03064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MAEQNITDDATRQPGSSSQVINDIVSGSNFDHEEVDRLWKRFMKLDRDQSGTIERDEFLS
LPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDG
FISNGELFIVLKMMVGSNLKDMQLQQIVDKTILEADMDGDGKISFEEFTRMVENTDVSMS
MTLDQF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacagaatattaccgatgacgcaacgagacagcccggctcaagctcccaggtg
atcaatgatattgtatcgggatccaatttcgatcatgaagaagttgacaggctctggaaa
cgtttcatgaaattggatagggatcaatccggtaccattgagcgcgatgaattcctatcc
ctccctcaagtttcctcgaatccgctttcaacccgaatgatagccatctttgacgaagac
ggtggtggtgatgtggattttcaagaattcgtttctggcctctcggcatttagctcgaaa
gggaacaaggaggaaaaactccgtttcgcgttcaaagtatacgatatcgatcgtgatggt
tttatttccaacggagaattattcattgtattgaagatgatggtggggagcaatttgaag
gatatgcagttacaacagatcgtcgacaagaccattctggaagcggatatggacggagat
gggaagataagttttgaggagtttacacgaatggttgaaaatactgatgtcagcatgagt
atgaccttggatcaattctga

DBGET integrated database retrieval system