KEGG   Uncinocarpus reesii: UREG_03084Help
Entry
UREG_03084        CDS       T01132                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ure  Uncinocarpus reesii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ure00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 175 aa AA seqDB search
MKAYWYDDEEGDQRAAHNSGRAVDESYLSKLGVLYRNCPNISDVDRLATERGYKNRDEIT
VSPEKMGQSYEQKVKMFFHEHLHEDEEIRYILDGEGYFDVRSEEDAWVRIAVEKNDLLVL
PAGIYHRFTTGESNYIKAMRLFQDEPKWTPLNRGPDLDENKHRKAYLESRAVAAV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatactggtatgacgatgaggagggtgaccaacgcgcagcgcataactccggg
cgcgctgtagacgaatcttacctctctaaactcggtgttctataccggaactgccccaat
atttccgatgtcgaccgccttgcaaccgaacggggttacaagaaccgggatgaaatcacg
gtctctcccgagaaaatgggccaaagctatgaacagaaagtgaagatgtttttccatgag
catttgcatgaggacgaggagattagatatattcttgatggcgagggatattttgatgtc
cggagcgaagaggacgcgtgggtgagaattgcggtggagaaaaatgatcttttggtgttg
cctgcgggaatttatcatcgattcacgacaggggagagcaactatatcaaagctatgcga
ttattccaagatgagcccaaatggacaccgttgaacagggggcctgacttggacgaaaac
aaacatcgaaaagcatacctcgagtctcgggctgtggctgctgtataa

DBGET integrated database retrieval system