KEGG   Uncinocarpus reesii: UREG_03180Help
Entry
UREG_03180        CDS       T01132                                 

Definition
dolichyl-phosphate-mannose--protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ure  Uncinocarpus reesii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ure00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 754 aa AA seqDB search
MANKDTGFATGASPGADVRRRNVPSSDKSSAGNGIPEILVDGKKAPAKLTVWNWQKSSFL
DVLDEWEFLIAPLIFTALAFFTRMWRIGLSNIVTWDEAHFGKFGSHYIKREFYFDVHPPL
GKMLVGLSGYLAGYNGSFEFKSGEKYPEEVNYTYMRIFNAFFGVVCVPLAYFTARELNFR
RATVWLVTLMVLFENSYATISRFILLDSMLLCFTFTTVLCWARFHRLQRQSFSAEWFAWL
FLTGLSIGFVCSVKMVGLFCTALVGLYTAEDLWNKFGDLKMPKTVLAQHVVVRVVGLIVV
PLLVYMFSFYIHFLVLENSGPGDAQMSSLFQANLRGTTVGKDSPLELAIGSKVTIKNMGY
GGGLLHSHVQTYPSGSSQQQVTCYHHKDTNNDWFIYPNRTQPEYDPEGELRFIGDGDIIR
LIHAQTGRNLHSHTIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDVASRDRTKIRTL
TTSFRLRHQSLGCYLRAANVNLPQWGFKQIETTCAKDSKPYDVHTHWNVESHVNERLPKS
DPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILNVGLRMCSWDNDT
VKYFLLGNPFVYWCSTASLGVFGLIFAWYLVRWQRGYTELSQADIDHIHYSGLYPLLGWV
LHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQKLNKPAEWAVYFILYAAVISLF
VVFKDIVFGMVGSNEQWQHLNWFSTWRIANPKSS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaaagacacggggttcgctacgggtgcctctcccggtgcggacgtgaggagg
agaaacgttcctagttcggataagtccagcgctgggaatgggatacctgagatactggtg
gatggcaagaaagctcctgcaaagctaaccgtttggaactggcagaaatcatcctttctt
gacgttctcgacgagtgggaattcctcatcgcgccgttgatattcactgccctggcgttt
tttacccggatgtggcgcattggtctgtcgaacatcgtgacatgggacgaggctcatttt
ggcaagttcggctcccattacatcaaacgcgaattctactttgacgtgcatcctccgctg
ggtaaaatgcttgttggtctgtcaggatatctagctggttataatgggtcctttgaattc
aagtcaggcgaaaaatatcccgaagaggtcaattatacctacatgcgtatcttcaacgca
ttcttcggcgtggtatgcgtgccgctagcttatttcaccgctcgcgagcttaatttccgt
cgggcaactgtttggctggttacattgatggtcctcttcgagaactcctacgccacaatt
tcccgtttcattctcttagattcgatgcttctatgcttcacttttacaactgtcctctgc
tgggcccgcttccatcggctccagcgccagagcttctctgcggaatggtttgcatggctt
ttcttgaccggtctcagcattggatttgtttgtagtgtgaagatggtgggcttgttctgt
actgctctagttggcctttatacagccgaggatttatggaacaagtttggcgatttgaag
atgccaaagaccgttcttgctcaacatgtcgtggttcgtgtcgtagggcttatcgtcgta
ccactactggtgtacatgttctccttttacatccatttcctcgtcctcgaaaactccggt
cctggcgatgcacagatgagctcgcttttccaggcgaatttgagagggactacagtggga
aaggatagcccgttggaacttgccattggatccaaagtcaccatcaaaaacatggggtac
ggaggtggtctacttcactcccacgttcaaacttatccttctggctcttctcaacagcaa
gtcacatgctaccaccacaaggacacgaataatgactggttcatctaccctaaccgtact
caacctgaatatgatcctgagggcgaactgagattcattggcgacggggatattattcgt
ttgattcatgcccaaactggtcgcaatttacactcgcataccattcctgctccaatcaca
aagtcgaactgggaggtctcttgctacggaaataccactgttggcgacgacaaagaccat
tgggtagtggaagttgtgaatgatgtcgcttcacgggataggaccaaaattcgaactctc
accacatctttccgtctccgtcaccaatcactcggatgctacctccgtgctgctaatgtc
aatttaccccaatggggtttcaagcaaatcgaaacgacttgtgcgaaggacagcaagccc
tatgacgtccatacccattggaatgttgaatctcatgttaatgaaagacttcccaagagt
gatcctggtgcctacaaatcgccattcttaaaggactttatccatctgaatgttgccatg
atgacatcaaacaacgcgcttgtcccagacccagataagcaagatgacctggcctctaaa
tggtggcagtggcctatcctcaacgtcggtctccgcatgtgttcgtgggacaacgatact
gtcaaatatttccttctcggaaatccctttgtctactggtgcagcacagccagcttgggt
gtctttggcttgatatttgcctggtaccttgtccgctggcagcgtggctataccgagctc
agccaagctgatatcgaccatatccactattccggcctttatccgctccttggatgggtt
cttcactacttgcccttcatcatcatggcacgcgttacttatgtccaccactactatcca
gcactctactttgcaatcctcactatgggattctgtgtcaactggttcactcagaaactc
aacaaaccggctgaatgggctgtatattttatcctttacgccgctgtcatttctctcttt
gtcgttttcaaggacattgtttttggtatggtgggatcaaacgagcagtggcagcacctt
aattggttcagcacttggcgcattgcgaatccgaaatcgtcttaa

DBGET integrated database retrieval system