KEGG   Uncinocarpus reesii: UREG_03243Help
Entry
UREG_03243        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UREG_03243
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_03243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 886 aa AA seqDB search
MNHHLPPLPHGQPPVPPPRRQHDMPYASAPPAMRSSPAYMGYHHPHSHATGPLPPYAPHQ
YQQQWYPYQQMPQPPPPPPYQSYSPLIVSSYPRSQHIAPGPPSFPLQTPPTSSTPQHSSF
TSTPPPAAPTSTTSDLQEDVSSARQGEAQPTKVDETLTSPVAVRTPSSVIPQAPTNESLK
DQAVAREPFQPPLPWLSVPEVPFPQRSSRRRRKPRVTTQSVALSFKANDATNEPPKTTSE
LVSPLPERSVTPTPTTSHPPSEPASTQPTTPLSAANPQAAIHTRQTSQTNASRPIVPIIP
VVPIVPTSPVVPKQGQQVTRKPNGSAKPSGSKDTDEPTQPNESKIEKQDASIVPPPRLQP
KSWADLVRTKKSTTAHNVVSSSGTSGLAPSKTESLVDVINSLGSDVDLYNNKITFIEPRG
LVNTGNMCYMNSILQVLIFCVPFYDFLDRISRRAAHSFKSELPFLDAMIMFMREFRVIDS
ATSVEQLRLRLKQNELEQYGASFIPEYVYQVIRHLPRFRDMRRGHQQDAQEFLGFLFEEL
HEECLHAMKSSATTSETASVNDVDATSMTDDSTTEGWLEVGHKQKPAVTRSAGHIAAESP
ITKIFGGKIRSEFRVPGNKNSVTLEPYQSLQLDIGSPQVNNIIDALKGLTRPETMHGDFS
SSRGTKATATKQVFIESLPPVLILHLKRFQYDNVTKGTQKIWKKVGYPLELEIPKEVFPP
HRRNILAAQGGGLPKYRLTGVIYHHGKNASGGHYTVEIRRQDGREWVRIDDTVIRRVRSE
DVAFGGNDEDPKALAAALEQHKSMEDGQSNIFRHFDQDDDQDNDRGWNHVNGSGSGHASK
KSVSTLANGTGTQNTASGDASGKGTPSSRLAARENKVAYLLFYQQI
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatctgcccccgctgcctcacgggcaaccacccgtgccgccccctcgccgg
cagcatgatatgccatatgcttctgcgccgcctgctatgcgctcttctccagcctatatg
ggctaccatcaccctcattcccatgcgaccggccctcttcctccatacgcgccgcaccag
tatcagcagcaatggtatccttatcaacagatgccacaacctccgccacctccaccgtac
caatcatatagccctttgatcgtttcctcttaccctcgttcacagcatatcgcgcccggt
cctccgtccttccctttacaaacaccgccaacctcgtcaacacctcaacattcctccttc
acttccacgccaccccctgcagcacccacttccaccacgtcagatttgcaagaagatgtt
tcttcagcaagacaaggagaggctcagccaacgaaagtagatgaaactttgacatctccc
gttgctgtgcggactcccagttcagtgatcccccaagccccaaccaacgaatccttgaag
gatcaagcagttgctagagagccgtttcagccaccgcttccttggttatcagttcccgag
gttccgttccctcaacgatcgtcaagacgacgtcgaaaacccagagtgacaacgcaatct
gtggctctttcattcaaagccaacgacgcgaccaatgaaccccctaagaccaccagtgaa
ttagtatccccgttgcctgagcgttctgttactcccactccgacaacctctcatccccct
tctgagcctgcatcgacacaaccaacaactccgttgtctgctgccaacccacaagcagca
atccatacccgccaaacttcgcaaacgaatgcgtcacggccaatagtccctatcatccca
gttgttcccattgtgccaactagtcccgttgttccgaaacaggggcaacaagtcactagg
aagcctaatggatccgcaaagcccagcggatcgaaagatactgatgagccaacgcagcct
aacgagagcaaaatagagaaacaggatgccagtatcgtgcctccccctcgtttacagcca
aagtcctgggccgaccttgttcgaacaaagaaatcgaccacggctcacaatgtcgtgtct
tcatcgggaaccagcggattggcgccatcgaaaaccgagtctcttgttgacgttattaac
agtctaggctccgatgtagatctctataacaataagattacctttatcgagccccgaggc
cttgtaaatacagggaatatgtgttatatgaattccattctgcaagttctcatcttctgc
gtcccgttttatgatttccttgatcggatcagtcgtcgtgctgcgcacagtttcaagagc
gagcttccattccttgatgcaatgattatgtttatgagagaatttagagtaatcgattcg
gcgacctcggttgagcagttgagactacgcctgaagcaaaacgaacttgagcaatacggg
gcatcatttattccagaatatgtttatcaggtcatcaggcatcttcctcgttttagagac
atgcgacgaggtcaccagcaagacgctcaagagtttctcggtttcctatttgaggaactt
cacgaagaatgtttgcatgcaatgaaaagttctgctacaacatcggaaacggctagcgtt
aatgatgtcgacgctacttccatgacagatgactccactacagagggatggctggaggtt
gggcataagcaaaagcccgctgtgacacggtcggccggacacatcgctgcagaatctcct
atcacaaagatattcggtgggaagattagatccgagtttagggtgcctggaaataaaaat
tcggttaccctagaaccctaccagtcgcttcaacttgacatcggttctcctcaagttaac
aatatcatcgatgcattgaaagggctcaccagaccagaaactatgcatggagacttcagc
tcatcacgcggtaccaaagccactgccaccaaacaggtgtttatcgagagtcttccaccg
gttttgattcttcacttgaagcgttttcaatatgacaatgtaacgaagggcacccagaaa
atttggaagaaagttggataccccttggaacttgaaattccgaaagaagttttcccccca
caccgacggaatatactcgctgcccagggtggaggtcttcccaagtatcgacttactggt
gttatttaccaccatggcaaaaatgcaagtgggggccattatacggtcgaaatccgccgt
caagatggacgcgaatgggtccgtattgacgatactgtcatccgccgtgtccgaagcgag
gatgttgcgtttggaggaaatgacgaagacccaaaggccttggcggctgctcttgaacag
cacaagtctatggaggacggacagtcgaacatcttccgccatttcgatcaagacgatgac
caggacaacgatcgtggatggaaccacgtcaacggctcaggctcaggccatgcaagcaaa
aaatcagtcagcactctagccaatggaacgggcacgcagaacaccgcatctggcgacgcc
tctgggaagggaacccctagcagccggttggcagctcgggagaacaaggtcgcatatctc
ctcttttaccaacaaatttaa

DBGET integrated database retrieval system