KEGG   Uncinocarpus reesii: UREG_03573Help
Entry
UREG_03573        CDS       T01132                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00630  Glyoxylate and dicarboxylate metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01200  Carbon metabolism
Module
ure_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UREG_03573
Enzymes [BR:ure01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     UREG_03573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase DUF2458
Motif
Other DBs
NCBI-GeneID: 8437475
NCBI-ProteinID: XP_002544056
UniProt: C4JR91
AA seq 603 aa AA seqDB search
MFRNASRCFPRQLRLAGQPPHPALLPRAAAGRLAYTSVRMASRLPAVKPPVSIEFPADAY
QLLSTSEKAGAAEDALFEEQVNAVNQWWATPRYEGIKRPYSAADVVSKRGSLQQAYPSSL
MARKLFNLLNEKAAKGEPLHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPD
FGDYPYNTVPNQVQRLFKAQQMHDRRHWDARRKLTPEQKKATPYVDYLRPIVADGDTGHG
GLTAVMKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDLM
GTENLVIARTDSESGKLLSSTIDVRDHEFILGVTEAGEPLSETLQKMELDGATGAEIDAF
ESKWVKEHKLVTFDEAVEQHLVSEGASEATINEYTTKVRENRDMSISQRRALADEFTKSP
VFWSWDIPRTREGYYHYRAGEAAAVKRAINFAPYADLLWVETGDPNVKNAARFAGEIREQ
FPGKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAKHGFVLQLISLAGLHTNATVTTELSR
GFKEDGMLSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGVLGSILSGSSSNKSMGEGNTE
SGF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcaacgcctctcgctgcttcccccgccagctccgactcgccggacaacctccg
cacccggccctcctccctcgcgccgctgctgggcgtcttgcctacacgtcggttcgaatg
gcgtcgcggcttccagcagtcaagccgcctgtgtcgattgaatttcctgcagacgcctat
cagctgctctcgacgtcggagaaagcaggcgccgccgaagatgcgctcttcgaggagcag
gtcaacgccgtcaaccagtggtgggcaacgccccggtacgaaggcattaaacggccctat
tcggctgcggatgtcgtcagcaaacgagggtccttgcagcaggcgtatcccagctcgttg
atggcgcggaaactcttcaaccttttgaatgaaaaggccgccaagggggagcctttgcac
acgcttggcgcaatcgacccggttcagatgacgcagcaagcccctaaccaagaagtcctg
tacatctccggatgggcctgctcgtctctgctgacaaccaccaacgaagtttcgcctgac
tttggcgactatccgtacaatacagttccgaaccaagtccagcgtctgttcaaggcgcaa
cagatgcatgaccgcagacattgggatgcgcgacgaaagctcactcccgaacagaaaaaa
gccactccatacgtcgactatctgcggccaatcgtggcagacggcgacacaggacacggg
ggcttgaccgcagtgatgaagcttgcgaagctatttgctgaaaacggtgccgccgcggtc
cacttcgaagatcagctccatggggggaagaagtgtggacatcttgctggaaaggtcttg
gtccccatcgccgaacacatcaatcgattggtagccgcacgattccaatgggatctcatg
ggaactgaaaatctggtcatcgccaggactgattccgaaagtggaaagctactcagcagc
accattgacgttcgagaccacgaattcattctcggagttactgaggccggtgagccgctg
tcggaaacattgcaaaagatggagctggatggcgctactggagctgaaatcgacgcattc
gagtccaagtgggtgaaggaacataaactggtgacattcgatgaagccgtggaacagcac
ctcgtctccgagggcgcatccgaagccaccatcaacgagtacacaacaaaggttcgcgag
aatcgggacatgtccatctcgcagcgtcgagctctcgcggacgaattcacaaagtcaccg
gtgttctggtcgtgggacattccaagaacccgcgaaggctactatcactatcgcgccggt
gaagcggctgctgtcaagcgcgcaatcaactttgcgccttatgccgatctcctttgggtt
gaaaccggtgacccgaatgtcaagaatgccgctagatttgctggtgaaattcgagagcag
ttcccaggcaagaaattggtttacaatctcagcccttcatttaactggatgggacagggc
tttgacgaagccagcctgaagtcattcatctgggaccttgcaaagcatggatttgtgcta
caacttatctcactcgctggccttcacaccaacgcaacggtgaccactgagctctccaga
ggtttcaaggaggacggcatgctttcatacgtgaaccttgtccagaagcgcgaaaaggag
atgggagttgacgttctcacccaccagaaatggagcggcgccccgtatgtggatggtgtt
ttggggtccatcctcagcggtagcagctccaataagagcatgggtgaaggaaacactgaa
tcaggcttctaa

DBGET integrated database retrieval system