KEGG   Uncinocarpus reesii: UREG_03573Help
Entry
UREG_03573        CDS       T01132                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ure01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ure00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 603 aa AA seqDB search
MFRNASRCFPRQLRLAGQPPHPALLPRAAAGRLAYTSVRMASRLPAVKPPVSIEFPADAY
QLLSTSEKAGAAEDALFEEQVNAVNQWWATPRYEGIKRPYSAADVVSKRGSLQQAYPSSL
MARKLFNLLNEKAAKGEPLHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPD
FGDYPYNTVPNQVQRLFKAQQMHDRRHWDARRKLTPEQKKATPYVDYLRPIVADGDTGHG
GLTAVMKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDLM
GTENLVIARTDSESGKLLSSTIDVRDHEFILGVTEAGEPLSETLQKMELDGATGAEIDAF
ESKWVKEHKLVTFDEAVEQHLVSEGASEATINEYTTKVRENRDMSISQRRALADEFTKSP
VFWSWDIPRTREGYYHYRAGEAAAVKRAINFAPYADLLWVETGDPNVKNAARFAGEIREQ
FPGKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAKHGFVLQLISLAGLHTNATVTTELSR
GFKEDGMLSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGVLGSILSGSSSNKSMGEGNTE
SGF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcaacgcctctcgctgcttcccccgccagctccgactcgccggacaacctccg
cacccggccctcctccctcgcgccgctgctgggcgtcttgcctacacgtcggttcgaatg
gcgtcgcggcttccagcagtcaagccgcctgtgtcgattgaatttcctgcagacgcctat
cagctgctctcgacgtcggagaaagcaggcgccgccgaagatgcgctcttcgaggagcag
gtcaacgccgtcaaccagtggtgggcaacgccccggtacgaaggcattaaacggccctat
tcggctgcggatgtcgtcagcaaacgagggtccttgcagcaggcgtatcccagctcgttg
atggcgcggaaactcttcaaccttttgaatgaaaaggccgccaagggggagcctttgcac
acgcttggcgcaatcgacccggttcagatgacgcagcaagcccctaaccaagaagtcctg
tacatctccggatgggcctgctcgtctctgctgacaaccaccaacgaagtttcgcctgac
tttggcgactatccgtacaatacagttccgaaccaagtccagcgtctgttcaaggcgcaa
cagatgcatgaccgcagacattgggatgcgcgacgaaagctcactcccgaacagaaaaaa
gccactccatacgtcgactatctgcggccaatcgtggcagacggcgacacaggacacggg
ggcttgaccgcagtgatgaagcttgcgaagctatttgctgaaaacggtgccgccgcggtc
cacttcgaagatcagctccatggggggaagaagtgtggacatcttgctggaaaggtcttg
gtccccatcgccgaacacatcaatcgattggtagccgcacgattccaatgggatctcatg
ggaactgaaaatctggtcatcgccaggactgattccgaaagtggaaagctactcagcagc
accattgacgttcgagaccacgaattcattctcggagttactgaggccggtgagccgctg
tcggaaacattgcaaaagatggagctggatggcgctactggagctgaaatcgacgcattc
gagtccaagtgggtgaaggaacataaactggtgacattcgatgaagccgtggaacagcac
ctcgtctccgagggcgcatccgaagccaccatcaacgagtacacaacaaaggttcgcgag
aatcgggacatgtccatctcgcagcgtcgagctctcgcggacgaattcacaaagtcaccg
gtgttctggtcgtgggacattccaagaacccgcgaaggctactatcactatcgcgccggt
gaagcggctgctgtcaagcgcgcaatcaactttgcgccttatgccgatctcctttgggtt
gaaaccggtgacccgaatgtcaagaatgccgctagatttgctggtgaaattcgagagcag
ttcccaggcaagaaattggtttacaatctcagcccttcatttaactggatgggacagggc
tttgacgaagccagcctgaagtcattcatctgggaccttgcaaagcatggatttgtgcta
caacttatctcactcgctggccttcacaccaacgcaacggtgaccactgagctctccaga
ggtttcaaggaggacggcatgctttcatacgtgaaccttgtccagaagcgcgaaaaggag
atgggagttgacgttctcacccaccagaaatggagcggcgccccgtatgtggatggtgtt
ttggggtccatcctcagcggtagcagctccaataagagcatgggtgaaggaaacactgaa
tcaggcttctaa

DBGET integrated database retrieval system