KEGG   Uncinocarpus reesii: UREG_03589Help
Entry
UREG_03589        CDS       T01132                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ure  Uncinocarpus reesii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ure00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MAKDVESFIGSIDQGTTSSRFLIFNQNGEVVASHQLEFTQIYPQPGWHEHDPIEIVTSVE
RCIDGAVSSFEHQGYNVGSIKAVGITNQRETTVVWNKETGEPLYNAIVWTDTRTQSLIRR
LKQRLGHSELQEHCGLPLSTYPSVGKLLWLLDCVPRVKEAYENGVLAFGTIDTWLVYKLN
GGPKNNVFVTDPSNASRTMFMDIRTRQYSETLIDFFRLNRTKLHLPTIIHSSDPKGYGSL
ASTVLRGVPITGCLGDQSAALVGQKGFTPGKAKNTYGTGCFLLYNVGENPVISNHGLLTT
VAYDFGGEVMYALEGSIAVAGSSVKFLKDNFEFVKSSEEINRLAETVEDNGGCVFVTAFS
GLFAPYWIDDARGTIFGITTYTKRGHIARATLEATCFQTKAILDAMAKDSGRALTELAVD
GGMCNSDLTMQTQADLISIPVNRPAMRETTAFGAAIAAGLAVGFWQDVQELESVNVDGQT
VFEPKVPKAEAEKRFEQWEKAVQMCRGWAS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagacgtcgaatcgtttattgggtcgatcgatcaggggacgacaagctctagg
tttttgatatttaaccaaaacggagaagtcgtagcctcgcatcagttggaatttacccag
atatacccgcaaccgggttggcatgaacacgatccgatagaaattgtcacatctgtggaa
aggtgtatcgacggcgctgtatccagcttcgaacatcaaggttacaatgtgggatcaatc
aaagccgtcggtatcacgaaccaaagagagactaccgtcgtttggaataaggaaaccgga
gagccactgtataatgcgattgtgtggacggatactcgaacgcagtcactaatccggaga
ctaaagcagcggttggggcatagtgagcttcaggagcactgtggtcttcccttatcaacg
tacccttcggtggggaaactcctctggctcctggattgtgtgcccagggttaaagaggct
tatgaaaacggcgtccttgcttttgggacaatagacacctggttggtttataaactcaat
ggcgggccgaagaataatgtctttgtgacggatccttcaaacgcgtctcgaacgatgttc
atggacataagaactcgccagtacagtgaaaccctaatcgacttcttccgactaaatcgg
acgaagttacatttgccaaccataatccattcgtctgatccaaagggatacgggtcactg
gcctcaacagttttaaggggtgtgccaataacgggctgccttggcgatcaatcggctgcc
cttgtagggcaaaaaggatttactcccggcaaggccaaaaatacctatgggacgggctgc
ttcttgctgtacaatgtgggcgagaatcctgtgatctccaaccacggactgctcacgact
gttgcatacgattttggcggcgaagtgatgtatgcgctagaaggcagtattgccgtagct
ggctcaagtgttaaatttctcaaggacaactttgaatttgtcaagtcatccgaagaaata
aacaggctggcggagacggttgaggataacggtggatgtgtctttgtcacggccttcagt
ggactttttgcaccatactggatagacgacgcccgggggactattttcggcattaccaca
tatactaagcgcggacatatcgcccgcgcaacattggaagcgacatgtttccaaacaaaa
gcgatactcgatgccatggcgaaggacagtggtcgagcgctgacggagttagccgtggat
ggtgggatgtgcaacagcgatttgacaatgcaaacacaagcggatctcatctcgataccc
gttaatcggcccgcgatgcgagaaaccactgcttttggagcggccattgcggcagggctc
gcggtgggattttggcaagatgttcaagagctggaatccgtgaatgtagatggacaaacg
gtattcgagccaaaggtgccaaaggcagaggctgagaaacgcttcgagcagtgggagaag
gcggttcagatgtgccgcggatgggcaagctga

DBGET integrated database retrieval system