KEGG   Uncinocarpus reesii: UREG_03646Help
Entry
UREG_03646        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ure  Uncinocarpus reesii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ure00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ure04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1147 aa AA seqDB search
MAYPSSDSDGRPRSGSKSSSEFSQVTPLEDAFTSLSSSAPPDWQFNSASMSTSSITFQKP
FPSFSAVTSPLHMSVDTSATTFRNDSVETPLLASPLPLELPEPVLSIATQSVFTDGPLGN
AAFNKAPGLMRRLSRGAASKLSRRRLSNSHDTRDNSSGPVILRRRSDSKTSVSKDSALES
SVEEDEKSEARKNRGPLEGSTFSGEYPLSWATTAGVAPRVDPLLQCGSLLTKVTKQKKKR
KTFFLDVDAAKVYWDLSNPSKRFYIDDIKEIRLGQDARNYREEHQVPIEFENRWFTIIFA
NPEGSKNKPVKTMHLIAPSRTVFELWTTTLEQISRYRIGLMVGLAGSGQSEAILKAHWQR
EIGRRFPGKPGLAEEKCLDLGAVENLCHSLHINCSKSVLRLQFARVDIGGTGEINFSQFQ
AFVQHLKARRDVRNIFASVETTNGLSMEEFFDFLRNTQAEDVDNRKEYWTSVFESFVQKS
RLRSQSLPTPLSGSSARMNLDAFSSFLMSTANSIYPTDVPQPKFDLPLNDYFISSSHNTY
LLGRQVAGASSTEAYITALQKGCRCVEIDCWDGADGRPIVSHGRTMTTSVLFADCIAVIN
RYAFLSSEYPLILSLEVHCNSEQQLLMASIMKDVFGEKLLLEPLRANWPILPSPEALKGR
ILIKVKTSDECEGNSATVGSGKAVGRKRSSSSPFLPSAAQNPFPTYSPLSSPPTIGPIDG
LPPILAQPKRSLTGASLSSASEESDAAFAALAFQKDKKKMPKSRVIKGLADLGVYARGYK
WRGFDTPESKQFNHVYSFAERSFETICRDRENKALLEAHNRLYLTRVYPSGYRLRSSNFD
PNSFWRRGAQMAALNWQTYDVGMQMNQAMFAAGNDRTGYVLKPESLRVPPSLNYTTDGKP
KIDRQLLRFSVDVISAQQLPRSRGMGPDDSINPYIEIEILSADDKKKGVAYGEGGVNASN
RNGLSGIGLPHRRRTRIEQKNGFNPIFGDQFRFSLETKYPDLVFIRWIVWNSTDGRSFGG
NNSTQLATFTAKLSSLNQGYRYLPLYDSNGDQYLFSTLFCRITKFESVPSPQQVNVEESK
SERMGIFRQLGQSMFKRALSTEREKEASRERDRLIEGIRKDSLSREKNEPSSSSSSLPMA
TNASSAQ
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggcctatccgtcgagcgactcagacggacgtcctagatcaggctctaaatcatcgtcc
gaattttcccaggtgactccattagaagatgccttcacgtccctcagctcttcagcgccc
cctgactggcagttcaactctgcatcgatgtccacctcttctattacttttcaaaagccg
tttccaagcttcagtgccgtcacctcaccactgcacatgtcggtagatacttcagccaca
accttccgaaatgattccgttgaaacaccgctgcttgcgtcaccgttgccattggaactt
ccagagccggtattgagtattgctacgcaatccgttttcactgatggacctttgggaaac
gccgctttcaataaggcccctggattgatgcgaagattatccagaggtgcggccagtaag
ctttctcggcgaaggctatcaaattcccacgacacgcgagataacagttcggggcccgtc
atactgcgcagaagaagcgatagtaagacttcagtctccaaagatagtgccttagagtca
agtgttgaagaggatgaaaaatccgaggctcgtaaaaatcgtggccctctcgaaggaagc
acattcagcggcgaatacccgttatcctgggctactaccgcaggggtggcgccgagagtc
gaccctcttttacagtgtggctcacttctcacaaaagtgaccaaacagaagaagaaacgg
aagacattctttcttgatgtcgatgcagctaaagtgtactgggatctctcaaacccgtcc
aagagattttatatcgacgacatcaaagaaataagactgggccaggatgcgcggaattat
cgagaggaacatcaggtcccaattgaatttgagaatcgctggttcacaattatcttcgct
aatcccgaagggtccaagaacaagcctgttaagacaatgcacttgatcgcaccgagtcgg
accgtttttgagctgtggactaccaccctagagcagatctccaggtacagaattggactt
atggttggcctagctggctccggccaaagtgaggctatattgaaggcgcactggcaacgc
gaaatcggaagacgtttccctgggaagcctggccttgctgaagaaaagtgcctcgacctt
ggagctgtggaaaatctttgccatagccttcacatcaactgttctaaatctgttttacgt
cttcagtttgcgagagtcgatataggtggaaccggggagatcaacttctcccaatttcag
gcttttgtgcaacaccttaaagctcgcagagacgtgagaaacatttttgcatccgtggaa
acaacaaacggtttaagcatggaagagttctttgacttccttcgcaatacacaggcggaa
gatgtcgacaatcgcaaagaatactggacttccgtttttgaaagcttcgtccaaaaatca
agacttcgatcacaaagccttccaacacccctctctggctcatctgcgcgcatgaatctt
gatgctttttcgtcattcttgatgtccacagcgaatagcatttacccaaccgatgtaccc
cagccaaagtttgacttgccgctgaacgactatttcatttcgagctctcacaacacgtac
cttttgggaagacaagtagctggtgcctccagcacagaagcgtatattaccgcccttcag
aagggttgccgttgtgtcgagatcgactgctgggatggcgccgatggtcgtccgatagtg
tcccatggcaggacgatgaccaccagcgtcttgtttgcagattgtatagcagttatcaat
cgttatgcatttttgtcgtctgagtatccgctgatattgtcgctcgaagtccactgtaac
tcagagcaacaactcctcatggccagcatcatgaaggatgtctttggtgaaaaactcctc
cttgaaccgcttagggcgaattggccaatccttccgagtccggaagccttgaagggccga
attctcatcaaggtgaaaacatccgacgagtgtgaaggaaatagcgcaactgtcggttct
ggtaaagctgtgggccgcaaacgaagctccagttctcctttcctaccttcagctgctcaa
aacccatttccaacttactcgccgttatcttctccgccaacaatcgggcccattgatggg
ttacccccaattctggctcaaccaaagcgctctctcactggagctagcttgagcagcgcc
tctgaagaaagcgatgcagccttcgcagccctagcctttcagaaggacaagaagaagatg
cccaaaagcagggtcatcaaaggccttgcagaccttggcgtttatgctcgtggttataaa
tggcgagggttcgacactcctgaaagtaaacagttcaaccacgtgtactcctttgcggaa
agatcttttgaaacaatatgccgagaccgtgaaaataaggcacttctggaggcgcataat
cgcctatatctgacgagagtttatccgtccggatatcgtctgcgttcgtcaaactttgac
ccgaatagtttctggcggcgtggtgctcagatggctgcactcaattggcaaacctacgac
gttggtatgcagatgaatcaagccatgtttgcggcgggaaatgatcgtactggatatgtg
ttaaaaccggaaagcctacgtgttccaccatcgttgaattatacaacagacggaaagcca
aagattgatcggcaattgctccgctttagcgtggacgtgatctctgctcaacaacttcct
cgatccagaggcatgggtcctgacgatagtattaacccatacatcgagattgagattctc
agcgccgatgacaagaagaaaggtgttgcgtacggcgaaggcggagtgaacgcttccaac
cgcaatggattatcgggtatcggtcttcctcatcgtcgtcggacgaggatcgagcagaag
aacggattcaaccctattttcggagaccagttcagattctccctagagactaaatacccc
gatctcgtctttattcgttggatcgtatggaactccacggatggccgtagcttcgggggc
aataatagcacgcagctcgctacattcacggctaagcttagcagtttgaaccagggttat
aggtatttaccactttatgatagcaacggtgatcagtacctcttttcgaccctattctgc
cgaatcaccaagtttgagtctgtcccttctccgcaacaagtgaacgtcgaagaatcgaag
agcgagcgtatgggtatctttcgacagcttggccagtcaatgttcaaacgtgctctgtcg
acagaaagagagaaggaggcatctcgagagcgggacaggctcatcgagggcatccgaaag
gactcgctgagccgagaaaaaaatgaaccatcgtcgtcatcatcgtcgcttccaatggcc
acgaacgcctcgtcggctcagtga

DBGET integrated database retrieval system