KEGG   Uncinocarpus reesii: UREG_03689Help
Entry
UREG_03689        CDS       T01132                                 

Definition
vacuolar ATP synthase 16 kDa proteolipid subunit 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ure  Uncinocarpus reesii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    UREG_03689
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     UREG_03689
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   UREG_03689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MTKHSSKHVTVCGFRLMTASEPMFWVQEALQLRWESQAGIASAMIFGSLGAAYGTAKAGI
GIANVGTFRPDLIMKSLVPVVMAGIIAVYGLVVAVLIAGDIGTPAQNYSLYAGSIHLAAG
LAVGLSGLAAGYAIGIVGDAPHRCVDSKFEALIAILEASGAQECPEHSTGELGWLTFSTC
RREILPFSPMATETIPQTQEQLSKPPPSDQHRPEIDPGQDINAKKIGFPPWPASRPKTPP
DIVENRKHIKERIPKHKLKIEDFELLKTLGTGTFARVWLVRLKNPKDKANSIFALKILRK
ADVIELKQVEHVKNENRALHAVAGHPFITTLIASFSDDQCLYMLLDFCPGGEIFSFLRRV
RRFNESTAQFYAAEISANLLIEDPNPLRIYEQIIEGRLRFPPHVSPEARDIIKRLGHISG
GTQRIKDHPFFKVINWDDLYRRRRNGPIIPRVDHAADAGNFEEYPPPPDPSTQSVYTDEM
RRKYEGLFKDFDDS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcacagcagcaagcacgtgactgtctgtggcttccgtctgatgacggccagt
gagccaatgttctgggttcaagaggctctgcagctaagatgggaatcacaggcagggata
gcatcagctatgatattcggatcactcggagcggcttacggcacggcaaaggctggcatc
gggatcgcgaatgtcggaacctttcgaccagacttgatcatgaaatcactggtccccgtt
gtcatggctggtataattgcagtttacgggttggtcgtcgcggttctcattgccggtgat
attggcactccagcacagaactacagtttatatgcgggctccatacatcttgcagctggg
ttggctgttggtctctcaggattagctgcgggctacgccattgggatagtcggggatgct
cctcatcgttgcgttgattctaaattcgaagcgctgatcgcaatccttgaagcttccgga
gctcaggaatgccccgaacatagcactggagagcttggttggttaacattttcgacgtgc
agacgcgagattttacccttttccccaatggcgacagagacgatcccgcagacgcaggag
caattgtccaagccgccaccgtcagatcagcaccgcccggagatcgatcccggacaagac
atcaacgctaagaaaattggtttccctccatggccggcgtctaggccgaaaactccacca
gacattgtggaaaatcggaaacatatcaaggagcgaattccaaagcacaaattgaagatt
gaagattttgaattgttaaagacattgggaactggtactttcgcgcgggtatggcttgtt
cgactgaagaatccgaaagacaaggcgaattcgatttttgctttgaagattcttcgcaaa
gctgatgttatcgagctcaaacaagtggaacatgttaagaatgagaatagagcacttcac
gctgttgccggccatccttttatcacaacattgattgcatcattttccgacgaccaatgt
ctatatatgctgctagatttctgccctggcggcgaaatattcagcttcctgcggcgagta
cgacggttcaacgaatccacggcccaattctatgcagccgagatatcggccaacctcctt
attgaggatccgaaccctttgcgaatatacgaacagatcatcgaggggcgcctgcgtttt
ccgccgcatgtttcaccagaagcacgggatatcataaaaagactgggtcacatatctggc
ggaacgcagcggatcaaagatcaccccttttttaaggtgataaactgggatgatctatat
cgtcggcgaagaaacgggccgatcatacctcgtgtcgatcatgctgctgatgcaggcaat
tttgaggaatatccgcctccaccggaccctagtacacaaagtgtgtacacggatgagatg
agaaggaagtacgagggcttgttcaaagattttgacgattcctaa

DBGET integrated database retrieval system