KEGG   Uncinocarpus reesii: UREG_03848Help
Entry
UREG_03848        CDS       T01132                                 

Definition
similar to chitinase 3
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ure00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1014 aa AA seqDB search
MPPTLRSPGHNGAITNPRVICYYQTYYPNNGPDYVSTLPLLRNNCGVSHIILAAIHINAE
PGNITLNDHTPDDPRYTPLWAEMRVMQTMEIKVMGMLGGAAKGSYQRLDGGTTDFEAYYG
PLRDMIRAHNLDGLDLDVEEEMSLEGIVRLIDRLKSDFGDNFIITLAPVATAMVHGLKHL
SGFDYRELEAARGPKISWYNVQFYNGWGHMLHLSVYDTIMLQGWKPEKIVIGLLTNPANG
SQGYIPMETMSYVLATVLAKYPFFGGVSGWEYFNGMPGGGARPWEWAASISLIMAMRTIL
GTTADALGLTSMSSSSLPSGLTVEQRQSLCNGGLLSSSKVSHSIHTLGMLSSQANFIIAL
SSTTLRLLSYVFLRWIPGHPFTPIILTSLLVYLASIYLAREQEGSQRATGEHNKTRGKKS
KGKTQSDNGEKGHKNEGPRQATLETRKTERVSALRSLLLGVPSTTSKLASYATVGINIAL
ALLTLDFVLRGLIFYPTEDLSFSRVGYVSPTSAKIFVREPNENFPVHISYQEVEDGGTGK
SMMAGTLYSLEKSTDFTYPISITGLKPSTKYRYSLSNNQVGEFVTAPEPGSPEAESLTFV
TSSCIKPNFPYNPLSHPFRIHGVDILTSTLERLSSALRPAFMLFLGDFIYIDVPWRFGSS
TKHYRNEYRRVYSSPSWQIPPHSPANIPWIHTLDDHEIANDWASGNETPPYPAAADPYLH
YHVSVNPPIPEDRYSIPSNTTYFSFVNGPASFYLLDTRTYRSHPLQEDSTMLGPAQLQSL
LDYILRPEPEGVKWKIITSSVPFTKNWHVGTPDTWGGFLKERRKVFEAMWKAEYDLGVRV
VLLSGDRHEFAATRFPDPVLSSTSLPETFSGAGRGIHEFCTGPLSQFYLPVRSYRQEDNE
DVAIKYVPDGNFKFGLVHIGVDKSGDQPASYLTYSLYVNGKEVWRYRLAAPLAAPKGRVP
PPGEIIFDHVDNWEEGLRKNVGSWAAFARERSGWVGKATSKAWDGFLRSIRVDE
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaccctgcgaagtcccggccacaatggtgctattacgaatcctcgtgtgata
tgttattatcagacgtattatcctaacaatggacccgactatgtctctactctgccactc
ttaaggaacaactgcggggtatcacacattattcttgccgcaatacatatcaacgcggag
ccgggaaatattacacttaatgatcatacgcctgacgatccccggtatacgccattatgg
gcggaaatgcgtgtgatgcagacaatggagatcaaagtgatggggatgttgggcggtgct
gctaaagggagttatcagcggctggatggtggcacaaccgattttgaggcttattacggc
ccactgcgcgacatgatccgagcacataaccttgacgggcttgacctagacgtggaagag
gagatgtccctcgagggcatcgttcggctgattgaccgtctaaaatcggattttggggat
aatttcattattaccttggctcctgtcgcaacagccatggtacatggactgaaacacctc
tctggcttcgattatcgggaattggaggctgcaaggggcccaaaaatctcctggtataat
gttcaattctacaatggatggggccacatgcttcatctcagcgtttatgatactataatg
ctccaaggttggaagcccgaaaagatcgtaatcggtctcttgaccaatcctgcgaacggg
tctcaagggtatatcccgatggaaacaatgagttatgtcttagcaactgtgttggcgaag
tacccgttctttggaggggtatcaggctgggaatacttcaacgggatgcctgggggtggt
gcgcggccgtgggaatgggctgcttcgatctccttgataatggcaatgagaacgatcctg
gggacgactgcagatgctctgggtttaacatcaatgtcgtcatcgtctctgcccagtgga
ttgaccgttgaacaacgtcaatccttgtgcaatggaggtctgctgtcgagcagtaaagta
tcacattcaattcatactctcgggatgctgtcgtctcaagcaaatttcattatcgcattg
agctcaacaaccctgagactgctcagctatgttttccttcgctggattcctgggcacccg
tttacgccaataatcctcacaagtttgcttgtatatttggcctcgatttatcttgccaga
gagcaagaaggctcccaacgagctacaggagaacataataaaactcgagggaagaaatca
aaaggcaaaacgcagagtgacaatggagaaaaaggccacaagaatgagggcccacgccag
gctacactggaaaccaggaaaaccgagcgagtatctgctttgaggtccttgttactgggc
gtaccatcaacaacttcaaagctcgcgagctacgcaacagtaggaatcaacattgctttg
gctctcctgacgcttgatttcgttctacggggccttattttctatccaaccgaagatctt
tcgttttctcgagttggatatgtgtctccaacttccgcaaagattttcgtgcgagagccg
aacgaaaactttccggtgcatatttcatatcaggaggtcgaagatggcggaactgggaaa
tcaatgatggcaggaacgttgtattcacttgaaaagtcgactgactttacttatcccatt
tcaatcaccggacttaagccttcgacgaagtaccggtattcgttgtcgaataaccaagtt
ggagagtttgtcacggcgccagaacccggttccccagaagcagaaagcttgacttttgtg
acctcgagttgcatcaagcccaacttcccctacaacccactgtctcaccctttccggatc
catggggtagatattcttacctcaactctagaacggttgagttcagcgcttcgtcctgct
tttatgctctttttgggtgacttcatctatattgatgtgccgtggcgatttgggtcgtcc
accaagcattaccgaaatgaataccgcagagtttactcctcgcctagttggcaaattcct
ccccattcgccagctaatattccatggattcataccctcgatgatcacgaaatcgcaaac
gattgggcctctggaaacgagactccgccgtacccagcggccgcggacccataccttcat
tatcatgttagcgtgaaccctcctattccagaagatcggtactctatcccgtccaacacc
acttatttttctttcgtcaacggcccggcctcattttatctactagatactaggacgtac
cgttctcacccgctacaggaagactcaaccatgttgggcccagcacagctacaatccctt
cttgactatattctacgtcccgagcctgagggtgtgaaatggaaaatcattaccagcagt
gtgcctttcacaaaaaattggcatgttggtacgcccgatacctggggtgggtttttgaaa
gaaaggcgcaaagttttcgaagccatgtggaaggcagaatacgatttgggagtgcgagtc
gttctactaagcggtgacaggcacgaatttgccgcgacccggttcccagatccagtcctc
tcatctacttctctccctgagacattttctggcgctggtagaggaattcatgagttctgt
actggcccgcttagccagttctacctcccggtgcggtcatatcgccaggaagataatgaa
gatgtggctatcaaatacgttcctgacgggaatttcaagtttggcctcgtgcatatcggc
gtcgataagagcggtgaccagcctgcctcttatctaacatattcattatatgtaaatgga
aaggaggtctggcggtacaggctggcagcacctttggcagccccaaaaggacgtgttcct
ccaccgggagaaatcatattcgaccatgtggataactgggaagagggattaagaaagaac
gtcgggtcatgggcggcgtttgcgcgtgagagatctggctgggtaggaaaagctacgagc
aaggcctgggatggatttctgagaagcattcgagttgacgaatga

DBGET integrated database retrieval system