KEGG   Uncinocarpus reesii: UREG_03894Help
Entry
UREG_03894        CDS       T01132                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E type 3
  KO
K03259  translation initiation factor 4E
Organism
ure  Uncinocarpus reesii
Pathway
ure03013  RNA transport
Module
ure_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_03894
Messenger RNA biogenesis [BR:ure03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     UREG_03894
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     UREG_03894
Translation factors [BR:ure03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    UREG_03894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 8441491
NCBI-ProteinID: XP_002544377
UniProt: C4JM36
AA seq 346 aa AA seqDB search
MENANLWTRRANSSRLSLSTAENRDSHARSDSPRGSSKRFGGDGHGRSNPFNAISPLSAS
VSSPSTNASSAFGLGSGAFASFGSATKTPKTPSAFDFGSKARSEKQEGEQSGVGVSKSVK
SKGSSSSLNSTGTPDAKEHLLKSTWVVWYRPPTPKYSDYEKSTIALASISSVESFWAVYS
HLKRPSLLPTVSDYHIFKKGIRPVWEDQANKKGGKWIVRLKKGVADRYWEELLLAMIGDQ
FAEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETMKRLLNFPADTNIVWKSHDDS
IAQRTAIDQARQDKASGNSNHHQGSDRRRGTHLDDSTGDKGKGSTS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcaaacttatggactcgaagagcgaactctagcaggctttctttgtcaacg
gctgagaaccgggactcacatgcaagatccgattccccgcgcggctcgtcgaaaagattt
ggcggtgacggccacggtcgttcaaaccccttcaacgcgatctcgcctctctccgcgagc
gtctcttcaccttctaccaacgcctcctctgcctttggccttggctctggagcgttcgct
tcattcgggtcggcgacgaagactccaaagacaccgagtgcttttgactttggttcgaaa
gctcggtccgaaaagcaggaaggggaacagagtggagttggggtttcgaagagtgtgaaa
tcgaagggctcgtcgtcttctctcaatagtacagggacccccgacgcgaaggagcattta
ttaaagtcgacatgggttgtctggtaccgcccccctacaccaaaatattccgattacgaa
aagtctacaattgccttggcgtcgatatcttctgttgagagcttctgggctgtttattcg
caccttaaaagaccttctcttctgcctacggtttccgattatcacatctttaagaagggc
attcgcccggtatgggaggaccaagcgaacaaaaagggtggaaaatggattgtgagacta
aagaagggggtcgcagatcgttattgggaagagcttcttttagccatgatcggtgatcag
tttgctgaggctagcgatgaggtttgtggtgctgttctcagtgtccggagtggggaggat
gtcttgagcgtctggactagaattgatggaggccgtaacattaaaattagggaaacaatg
aaacggctattgaatttcccggcggataccaacatcgtgtggaagagtcacgatgacagt
atagcccagagaaccgccattgaccaggctcggcaggacaaagcctctgggaattccaat
catcaccaaggctctgaccgtcgacgtgggacccatcttgacgattctaccggagacaag
ggaaagggttcgacctcttga

DBGET integrated database retrieval system