KEGG   Uncinocarpus reesii: UREG_03894Help
Entry
UREG_03894        CDS       T01132                                 

Definition
eukaryotic translation initiation factor 4E type 3
Orthology
K03259  
translation initiation factor 4E
Organism
ure  Uncinocarpus reesii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_03894
Translation factors [BR:ure03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    UREG_03894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 346 aa AA seqDB search
MENANLWTRRANSSRLSLSTAENRDSHARSDSPRGSSKRFGGDGHGRSNPFNAISPLSAS
VSSPSTNASSAFGLGSGAFASFGSATKTPKTPSAFDFGSKARSEKQEGEQSGVGVSKSVK
SKGSSSSLNSTGTPDAKEHLLKSTWVVWYRPPTPKYSDYEKSTIALASISSVESFWAVYS
HLKRPSLLPTVSDYHIFKKGIRPVWEDQANKKGGKWIVRLKKGVADRYWEELLLAMIGDQ
FAEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETMKRLLNFPADTNIVWKSHDDS
IAQRTAIDQARQDKASGNSNHHQGSDRRRGTHLDDSTGDKGKGSTS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcaaacttatggactcgaagagcgaactctagcaggctttctttgtcaacg
gctgagaaccgggactcacatgcaagatccgattccccgcgcggctcgtcgaaaagattt
ggcggtgacggccacggtcgttcaaaccccttcaacgcgatctcgcctctctccgcgagc
gtctcttcaccttctaccaacgcctcctctgcctttggccttggctctggagcgttcgct
tcattcgggtcggcgacgaagactccaaagacaccgagtgcttttgactttggttcgaaa
gctcggtccgaaaagcaggaaggggaacagagtggagttggggtttcgaagagtgtgaaa
tcgaagggctcgtcgtcttctctcaatagtacagggacccccgacgcgaaggagcattta
ttaaagtcgacatgggttgtctggtaccgcccccctacaccaaaatattccgattacgaa
aagtctacaattgccttggcgtcgatatcttctgttgagagcttctgggctgtttattcg
caccttaaaagaccttctcttctgcctacggtttccgattatcacatctttaagaagggc
attcgcccggtatgggaggaccaagcgaacaaaaagggtggaaaatggattgtgagacta
aagaagggggtcgcagatcgttattgggaagagcttcttttagccatgatcggtgatcag
tttgctgaggctagcgatgaggtttgtggtgctgttctcagtgtccggagtggggaggat
gtcttgagcgtctggactagaattgatggaggccgtaacattaaaattagggaaacaatg
aaacggctattgaatttcccggcggataccaacatcgtgtggaagagtcacgatgacagt
atagcccagagaaccgccattgaccaggctcggcaggacaaagcctctgggaattccaat
catcaccaaggctctgaccgtcgacgtgggacccatcttgacgattctaccggagacaag
ggaaagggttcgacctcttga

DBGET integrated database retrieval system