KEGG   Uncinocarpus reesii: UREG_03935Help
Entry
UREG_03935        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UREG_03935
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     UREG_03935
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     UREG_03935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 555 aa AA seqDB search
MGSLGTMAIEQDHDQLRAHGLYPESRILIIMTGGTICMRRSTAGFVPARGFLEAALRPSP
TFNDGSAPGPVDVAINAAGDRKSYPTLRTPLSAYEARVRYAVYEFEELLDSSSIDAKGWA
QIARTIYWNYTLFDGFVVLHGTDSLAYTSSALSFMFSNLGKPVILTGSQAPMLELQNDAT
DNLLGSLVIAGHFMIPEVCLYFNYNLFRGNRATKVAASDFAAFASPNCSPLAITSSMRTH
VKWDLVHKPTTIKHFSIQTNLDTTHVACLRIFPGIKPEMVDAVLRLPGLRGLVLETFGAG
NAPGGQDNAMTKVLADAINRGIVIVNVTQCLSGSVSPVYAPGMTLSRAGVVAGLDMTTEA
ALTKLAFLLGVPDATPQSVARDMAISVVGELTEHSHPVFRHPDGALPDRIKNLAALGYAI
AHGNLEKVKDIMRVEQDWILNDADYSGNTPLHLAATSPNLGILRYFLLHGGSVHLRNHAG
RTPLFLAANAGLVDHVSLLRQSGAHLNEDERGVAEMHARRRPEAWALAGVSTQAAANQLN
KPSDSEQERRANGKS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggctcactgggaaccatggcgatcgagcaagaccatgatcaactacgggcccatggc
ctctacccggaatctcgcattctcatcatcatgacaggagggacgatctgcatgcgccgt
tccacggccggcttcgtcccagcccgagggttcctggaagctgccctgcgaccctctcca
acgttcaatgacggttcggcgcctggcccggtcgacgtggccatcaacgcggcaggggac
cggaagagctatcccacactgcgtacgccgctgagtgcgtatgaggcgcgggtgcggtac
gctgtgtatgagtttgaggagctgcttgatagcagctcgattgacgcaaagggatgggca
cagattgcacggacgatctattggaactacacgctgttcgacggatttgttgttttgcat
ggaacggacagtctagcatatacatcctcggcgctgagcttcatgttcagcaacttgggc
aagccggtcatcctaacgggctcccaggcacccatgctggaacttcagaacgacgccaca
gataacctgctcggctcattggttatcgctggtcacttcatgattccggaggtgtgcttg
tatttcaattataatctatttcgggggaatagagctaccaaagtcgccgcgagcgatttc
gcggcgtttgcgtcgccgaactgttctcctctggctatcacctcgtcgatgcgcacacac
gtgaagtgggatctggtgcataagcctacgactatcaagcatttcagcattcaaacgaat
ctggataccactcacgtggcctgtctgcggatattccctggtatcaagccggagatggtc
gatgccgtgcttcgattgcccgggttgcgggggctagttctcgaaacctttggcgctggg
aatgcacctggaggtcaggacaatgccatgacaaaggtgcttgctgatgctattaaccgg
ggaattgttattgtcaacgtgacgcagtgtttatccgggagcgtgagcccggtatatgcg
ccaggcatgactttatcacgggccggtgtggtcgcagggttggatatgaccacagaagca
gcgctcacgaagctggcgtttttactgggggtacccgatgcaacaccgcagtccgtggct
cgagacatggcaatttccgtggtgggtgagcttacggaacactcacatcccgtattcagg
catcccgatggcgcgttgcccgaccggattaagaacctggctgcactcggctacgcaatc
gcccacggaaacttggaaaaagtaaaagacatcatgcgagtcgagcaggattggatactc
aacgacgcggattattccggaaacaccccgttgcacctggcggcgacttcacccaatctc
ggtatcctgcgatactttctcctccacggcggctctgtccatctccgcaaccacgcaggg
cgtacgccactattcctggccgccaacgctgggctcgtcgaccacgtttccttgctgcgg
cagtcgggcgcacacctgaacgaggacgagcggggggtagcggaaatgcatgcgcgtcga
cgaccagaggcgtgggcgctcgcgggagtgagcacacaggcggcggcgaatcagttaaat
aaaccgtccgattcggagcaggagagacgggcgaatgggaaatcgtga

DBGET integrated database retrieval system