KEGG   Uncinocarpus reesii: UREG_03962Help
Entry
UREG_03962        CDS       T01132                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ure  Uncinocarpus reesii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UREG_03962
Enzymes [BR:ure01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     UREG_03962
Glycosyltransferases [BR:ure01003]
 Polysaccharide
  Storage polysaccharide
   UREG_03962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 725 aa AA seqDB search
MAADGARPPPRKRDVKEHILFEVSTEVANRGWWFRDPIVSSNIWERELIAVPPAQVGGIY
SVLKSKAPVTTAEYGDRYTLIGPLNRASAVVEVEPLAPTNPQLLGAIDAMKERGIEIEYG
RWLIEGAPRVILIDTSAGYQYLDEWKGDLWNAAGIPSPAGDSETNEAIVFGYLVAWFLGE
YICRDTDRAVIAHFHEWLAGVALPLTKKRRMDMTTIFTTHATLLGRYLCAGSVDFYNNLQ
NFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVSHITAYESEHLLKRKPDGVLPNGLNVK
KFSAVHEFQNLHSHSKEKIHDFVRGNFYGHNDFDLENTLYFFIAGRYEYRNKGCGYMTSG
VVLYHGRCIIIMPAQTSSLTVEALKGQAVVKSLRDTLEMVEKGIGKRLFERCLSWHEGDN
MPDEKDLITAQDRVLIRRRLFAMKRHNLPPIVTHNMLNDPEDPILNQLRRVQLFNYPTDR
VKVVFHPEFLNSSNPVLPLDYDDFVRGTNLGVFPSYYEPWGYTPAECTVMGVPSITTNLS
GFGCYMEELIENSSDYGIYIVDRRLKGVDDSVNQLSQYMFDFASKSRRQRINQRNRTERL
SDLLDWKRMGMEYVKARQLALRRAYPMSFDPEEDFRDIIGGTEQKISRPLSIPGSPRDRT
GMMTPGDFASLQEGREGLSTDDYISWKLPSDEEEPDEYPFPVALRTKGKVEAPHSPDRDT
APNGS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagacggtgcgcgcccgccaccacggaaacgcgatgtcaaagaacacatccta
ttcgaagtgtctaccgaagtagcgaacagaggttggtggtttcgtgatcccatcgtgagc
tctaacatctgggaaagagagctaatcgctgttccccccgcacaagtcggcggcatctac
tcggttttgaagtcgaaagctccggtgaccaccgctgagtatggcgaccgatatacgttg
atcgggccgttaaatcgagcttcggctgtagtcgaagttgagccactggctcccaccaac
ccacagctgctgggagcgattgatgcgatgaaggagagaggaatcgaaatcgaatacggg
cgatggcttattgaaggggcccctcgagttatcttgattgatacaagtgctggctatcag
tacctcgacgaatggaaaggcgacctctggaatgctgccggtattccgtctcctgctgga
gacagcgaaacgaacgaagctattgtgtttggatatttggttgcctggttcctcggagag
tatatctgtagagacaccgatcgtgcggtgatcgcgcacttccacgaatggcttgcaggc
gtggccctgcccttgaccaagaagcgacgcatggatatgacgactatttttactacgcat
gccacccttctcggaaggtacctttgtgctgggtctgttgacttttacaacaatttgcag
aatttcgacgtcgatgctgaagccggaaagcgaggaatctatcatcgatactgtattgaa
cgcgcagccgcacattcagcggatgtcttcactaccgtctcgcatataaccgcatacgaa
agcgaacacctgcttaaacgaaagccggacggcgtcttgccaaacggcctcaatgtgaag
aaattctcggctgtccacgagtttcagaacctgcattctcactccaaggagaaaatacat
gatttcgtcagaggcaatttttacggccataacgattttgacctcgagaacacgctgtac
ttcttcatcgctggccgctatgaataccgaaacaaggggtgtggatatatgacgagcggc
gtggtcctctaccacggtcgttgcattattatcatgcctgctcagacatcatcgcttact
gttgaagcgctcaaaggccaagccgttgttaaatcgttgcgagacacattggagatggta
gagaagggaatcggaaagagattatttgagcgatgtttgagctggcatgaaggcgataac
atgccagatgagaaagatctcatcactgctcaggatcgcgtcctgatccgccgccggctc
tttgccatgaagcggcataatctacccccaatcgtgactcacaacatgcttaacgatcca
gaagacccgattctgaatcagcttcgccgagtgcaattgttcaactatcctactgaccga
gtgaaggtggtgttccacccagagttcctgaactcttcgaacccagtccttccattggac
tatgacgactttgttcgtggaacgaatcttggagtcttcccatcgtattacgaaccttgg
ggttataccccggccgagtgtaccgtgatgggggttcctagcatcactacgaacctatca
ggtttcggatgttatatggaggagctgattgagaattcctccgattatgggatttatatt
gtcgaccgccgcttgaagggggtagatgattcggttaaccagcttagccagtacatgttt
gactttgcctctaagagcagacggcagcgcattaaccagcgaaaccgaaccgaaagattg
agcgatttgttggactggaagaggatggggatggagtatgtgaaagcgcgacaattagct
cttagacgagcatatccaatgtcgtttgacccagaagaagatttccgtgatatcattgga
ggaacggagcaaaagatttcccgcccgctttccatcccaggctcaccgcgcgaccgaacg
ggcatgatgacgcccggagattttgcctcgcttcaggaaggacgagaaggcctcagcacc
gatgattacatatcatggaagttaccgagtgacgaagaagagcccgacgagtaccctttc
ccggtcgctcttaggacaaagggaaaagtcgaagctccccattcgccggatcgagacacg
gctcctaacggaagctaa

DBGET integrated database retrieval system