KEGG   Uncinocarpus reesii: UREG_04110Help
Entry
UREG_04110        CDS       T01132                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ure  Uncinocarpus reesii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UREG_04110
Enzymes [BR:ure01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     UREG_04110
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UREG_04110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 564 aa AA seqDB search
MTTPEGEQIDRIPAWIKRVTQDLKVSPVYDAVFWNPPKNEQYHFKHSRPIKPESLRIYEA
HVGISSPETTVASYKNFTEKMLPRIKYLGYNAIQLMAIMEHAYYASFGYQVNNFFAASSR
YGSPEDLKELIDTAHSLGLVVLLDVVHSHASKNVLDGLNMFDGSDHLYFHSGPKGNHELW
DSRLFNYGNHEVLRFLLSNLRFWMEEYQFDGFRFDGVTSMLYTHHGIGTGFSGGYHEYFG
PFVDDGGLTYLMLANEMLHQLYPNCITVAEDVSGMPALCLPLALGGVGFDYRLAMAVPDM
YIKLLKERSDEEWNMGHLAFTLTNRRHGEKTIAYAESHDQALVGDKSLMMWLCDKEMYTN
MSILSEFTPIIERGMSLHKMIRLITHGLGGEGYLNFEGNEFGHPEWLDFPRAGNQNSFWY
ARRQLNLTEDGLLRYKFLNEFDRKMQLTEEKYGWLHSPQAYVSLKHEEDKVIVFERAGLL
WVFNFNPTKSFADYRVGIDKPGTYRIVLDTDDSEFGGFNRNAKETRFFTAGEEWNGRSNY
IQVYIPSRTALVSLPVTYSFLGLI
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcctgaaggcgagcagattgatcggatcccagcatggataaagagagttact
caggatctcaaggtctcccctgtttacgatgcggtattctggaatcctcccaaaaatgag
caataccatttcaaacattcgcggcctatcaaaccagaaagccttcgaatttatgaggct
cacgttggtatatcttcaccagaaaccactgttgcaagttacaaaaacttcacggagaag
atgctgccgcgcattaaataccttggctacaatgctatccagctgatggccattatggaa
cacgcttattatgcaagtttcgggtatcaagtcaacaacttttttgcagcgagtagtcgc
tacggcagccctgaagatctgaaagaactcatagatacggcgcatagtctgggcctcgtc
gtcctcctcgatgtggtacatagccacgcgtcgaaaaatgtgctagatgggttgaacatg
ttcgatgggagtgaccatctttatttccattctgggccgaaaggcaaccatgagctttgg
gatagccgcctgttcaattatggaaaccatgaggttcttcgctttcttcttagcaacttg
cgtttttggatggaagagtatcaatttgatggcttccgcttcgatggtgtcacaagcatg
ctatatacccatcatggaattggaactggcttctcgggcggctatcatgaatacttcgga
ccattcgtcgatgacggcggtttgacctacctcatgcttgcaaatgagatgcttcaccaa
ttataccctaattgcatcactgtagcagaggatgtatcagggatgccggcactttgcttg
ccgcttgcgcttgggggcgtggggtttgattaccggttggccatggctgttcccgacatg
tacatcaagctcctgaaggagagatcagatgaggagtggaatatgggccaccttgctttt
actctaacaaaccgccgtcatggcgagaagacaatcgcatacgctgagagtcatgatcaa
gcgttggtgggagataaatcgctgatgatgtggctctgcgacaaggaaatgtatacgaac
atgtcgattctttcagaattcacgcccattattgagcgtggtatgagtctccacaaaatg
atccgcctaatcacacatggtttaggaggcgaaggctaccttaattttgaaggaaacgaa
tttggtcatcctgaatggcttgattttccgcgcgctggtaaccagaatagcttttggtat
gctcggaggcaattgaaccttaccgaggatgggctgctgcgctacaaatttctcaacgag
ttcgatcgcaagatgcaactaaccgaagagaagtacgggtggctccattcaccgcaagct
tatgttagcctcaaacatgaggaagataaagtcattgtattcgaacgggcagggctgctc
tgggtcttcaacttcaatcccaccaagagttttgcggattatcgggtcgggatagataag
ccaggtacctatagaatagtactcgacacggacgatagcgaattcggtgggtttaaccgc
aacgcgaaggagacgagattcttcaccgccggcgaagaatggaacggccggagcaattac
atccaagtgtatatcccttctcggacagcattggtaagccttcctgtgacttactccttc
ttaggtttgatctga

DBGET integrated database retrieval system