KEGG   Uncinocarpus reesii: UREG_04223Help
Entry
UREG_04223        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ure  Uncinocarpus reesii
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    UREG_04223
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    UREG_04223
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     UREG_04223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MPKPPGVPFPQASVSTISMQSIACAKDRLFCPQSNIQVFGIEWMTLLRKDCAPFHKAAFL
QTNRADLGLRYWNWALSANNLSASPLFDGSPTSFSGNGDPIDADPVIPLTPSNVSIPRGT
GGGCVTNGPFANMILNLPDLDSAPNDVFPPNGFHYSPHCLTRDLNTFIARAFTGQADVDR
LLASPDIATLQHNIDVSSWPAIREAGIMGPHAAAHMQLGRSMDDFWTAPQEPTFMLHHAM
VDRIWALWQAQDPENRRWALNGTSTIMNAPSTPEVDLDTQLTWGWLSENKTLREIMSTKA
YEYNYEYGD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccaccaggggttccctttccacaagcgagcgtctcgactatatcgatgcaa
tccattgcatgcgcgaaagaccgcctattttgcccacagagcaatatccaggtgttcggc
atcgaatggatgactttgctgcgtaaggattgcgctcctttccataaagctgcgtttctt
cagacgaatcgggctgatcttggattgcgatactggaactgggctctctcggcaaacaac
ctatccgcaagtcctctttttgacggaagtcccacgtctttctccggcaacggcgacccc
atcgatgccgaccctgtgataccgctgacacccagtaacgtgtcaattcctcgaggaact
ggcggcgggtgcgtcaccaatggcccgttcgcgaacatgatcctcaacttgcccgatcta
gactcggcgccaaatgacgttttcccgccaaatggcttccattactctccgcactgcctc
actcgggacctcaacacattcatcgcgcgagcgttcaccggtcaggcagatgtcgaccgc
ctgctggcttccccggacattgccacgctgcagcacaacatcgatgtaagtagttggccc
gcaatccgtgaagcaggcatcatggggccacatgcggcggcgcacatgcagctagggcgt
tcgatggatgatttctggacggcgccgcaggagcctacgtttatgttgcaccatgcaatg
gtggaccgcatttgggcgttgtggcaggcacaggatccggagaatcgacggtgggcgctg
aacgggaccagtacaatcatgaacgcgccatcgacgccggaagtagacctagatactcag
ttaacatggggttggctgagtgaaaataaaacacttcgcgagataatgagcaccaaagcg
tatgaatataactatgagtatggggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system