KEGG   Uncinocarpus reesii: UREG_04292Help
Entry
UREG_04292        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ure  Uncinocarpus reesii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ure03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ure03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MLEDQLYRTSTQYRLWSFTKESLGSIRQNTNSLASSRVKVAIRRAQEARRPASTPGESNG
ANSKDKGTAGTKEAVPCLTAEDELELVQYYCEKTLELGDEYKPPLPTTVRATAIQYLRRF
YLTNSPMTYHPKSIMPCAVFLATKTDNYYMPLRSFAEKIPNTTPEDIIAPEFLLTQGLRF
AFEIRHPFRGLEGGIMELTAIAQGNGSAAPHHTGVTSAMLQEIINSVPSPSPEGVAPASV
TDRIATAHGKSRQILKTAAQMTDAYFLYTPSQIWLSALLLVDKPLLDFYLDTKLARAKDD
PHPSWIPQVVPHLICDMHKLSALRGELDTVLANCSALLNAYLTSHDPNAPPDPARMKNLK
RIGKKLYHCQNPEKHSELNASGARAGKREGSGSVTPALLPTAGEDDTEGRTPKKRKLEAD
AADAG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaggaccagctttatagaacgtctactcaatatcgcctttggtcattcaccaag
gaatctctaggttccattcgacaaaacaccaattccctagccagctctcgagtcaaagtc
gccattcgccgagcgcaggaagcgcgtcgacccgcgtcgaccccaggagaaagcaatgga
gcaaattcaaaggacaaaggaactgcagggacgaaggaagcggttccatgcttgacggcg
gaagatgaattggaattggtgcaatactactgtgagaagacactggagctgggggacgaa
tataaacctccactaccgacaacggtgagggcgacagcgatccaatatctccgccgtttc
taccttaccaactcacccatgacctatcaccccaagtccattatgccttgcgccgtcttc
cttgccacgaaaacagataactactacatgcccctccgttcttttgccgagaagatacca
aacacaaccccggaggatattattgccccagaattcctacttacccagggcctccgtttc
gctttcgaaatccgccacccctttcgaggtttagaaggtggaatcatggaactcaccgcc
atagcacaaggcaacggatcagcagccccccatcacacaggagtaacatcggcaatgctc
caagaaattattaattctgtcccttcaccatccccagaaggagtggcaccagcttcagtg
actgaccggattgccaccgcccacggaaaatccagacagatcctcaagaccgcagctcaa
atgacagacgcctacttcctttacacaccatcgcagatatggctttccgcgcttttgctc
gtggacaaaccgctcctggatttctacctagacacaaagctcgcccgggcaaaagacgat
cctcacccatcatggataccacaggttgtcccccacctaatctgcgacatgcacaagctc
tcggctctccgtggagagctcgacactgtcctagcaaactgctctgctcttttaaacgcc
tatttgactagtcacgatcccaacgcccctcctgacccagctcgaatgaaaaacttaaag
cgcatcggcaagaagttatatcactgccagaatccagaaaaacattcggaattaaatgca
agtggcgctcgggctggaaaaagggagggttcagggagcgtgacaccggcattgctgcct
acggctggcgaggacgatactgagggtcgaacaccaaaaaagcgaaaattggaggccgat
gcagcggatgccggatga

DBGET integrated database retrieval system