KEGG   Uncinocarpus reesii: UREG_04331Help
Entry
UREG_04331        CDS       T01132                                 

Definition
similar to histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UREG_04331
Transfer RNA biogenesis [BR:ure03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    UREG_04331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 562 aa AA seqDB search
MATETLTLRPATQQRKLPKAAKLPPENERYMRACSDIANALIQDYEAQRDPSKPKKDINL
NKLRGQISKKHSLSTQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHR
CPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIRSL
GHSVDKVEYIIMGGTFMSLPEDYRDEFISQLHNALSGYQTNNVDEAVQAGEMSNTKCVGI
TIETRPDYCLDTHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAG
FKVVSHMMPDLPNMGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYK
NYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTC
RDVRTREVGINEVKNKIRPSQVELIRRDYVANGGWETFLAYEDPKQDILIGLLRLLWFAS
CMFMGSAVPVHGRDPRKFQHRGFGTLLMEEAERIARDEHGSRKLSVISGVGVRSYYAKLG
YWLDGPYMSKMLDPMTPEDDEC
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggagacgctcactctacgtcccgccacgcagcagcgcaagcttccaaaggcc
gcgaaactccctcctgaaaatgaacggtatatgcgggcatgctcggacatagcaaatgct
ctgatacaggattatgaagcccagagggatcccagcaagccgaagaaagatatcaacctc
aacaagctgcggggtcaaatctcgaagaaacacagcttaagcactcagccgccacttacg
gcaataatcgcagcggtcccggaacattataagaaatatatcttaccgaaactgattgcg
aagccgatcagaacatcttctggtatcgcggttgtcgctgtgatgtgcaaaccccatcga
tgccctcatattgcatatacgggaaacatttgtgtttattgtcctggcggccccgattca
gatttcgaatattccactcagtcgtacaccggatatgaacccacgtcgatgcgtgccatt
cgagcccgatatgatccctttgagcaggcgcgaggacgggtcgatcagattaggtccctt
ggacacagcgttgacaaggtggaatatattatcatgggtggaaccttcatgtccctgcca
gaggattatcgagacgaattcatctcgcaactacataatgcgctcagcgggtaccaaacg
aacaatgttgacgaggcggtccaggccggcgaaatgagcaacacaaagtgtgttgggatc
acgattgaaacccgtccggattattgtttagatacgcatctgagcgctatgctcagatac
ggctgcacacgattggaaataggtgtgcagagtctgtacgaagatgttgcgcgcgatacc
aaccggggtcacactgtggcggctgtcgcagagacattcaagctggcgaaagatgcaggg
ttcaaagtagtgagccacatgatgccagatcttccaaatatgggaatggaacgagacttg
ttccaatttcaagaatatttcgagaatccagctttccggactgacggtctcaaaatatat
ccaacacttgttattcgaggcaccgggctttatgaactttggcggactggtcgctataag
aattatactcctaacgccttgattgacattgtcgcccgaattctcgcactggttccccca
tggactcgcatttaccgcgtacagcgtgatatccctatgcctctcgttacctctggcgtg
gaaaatggtaatcttcgtgaactagcgctcagcaggatgaaagatttcggcaccacctgc
cgggacgtacgaactcgagaagttggaattaacgaagtgaagaacaaaattcgacctagc
caggtcgagttgattcgacgcgattacgttgccaacggcggatgggagacgttcctcgcc
tacgaagacccgaaacaagatatccttattggactgcttcgtctactttggttcgcgagc
tgcatgtttatgggttcagctgtccccgttcatggtcgcgatcctcgaaagttccagcac
cgtggattcggaacgttgctgatggaggaggcggaaaggatagctagagacgagcatggt
agccgaaagctcagcgtcatatctggtgttggggtcaggagttactatgcaaaacttggg
tattggcttgatgggccgtatatgagcaaaatgctcgatccgatgacgccagaggatgat
gaatgctaa

DBGET integrated database retrieval system