KEGG   Uncinocarpus reesii: UREG_04485Help
Entry
UREG_04485        CDS       T01132                                 

Definition
similar to ubiquitin carboxyl-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UREG_04485
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_04485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MATIPVIVKHQGKRFEVELDPTANGETFKFQLYSLTGVEPERQKILIKGGQLKDETDLGS
LGVKPGQTFMMMGTPGSGDPGMVLRKPKETPKFMEDMTEAEAARAEGATPAGLQNLGNTC
YLNSTLQTLRALPELQEELQNYKPLRQPQSSLFTPSTAIDLTASLRDLYKQMSETQEGFP
PMMFLNALRSAFPQFAQKARDGRGYAQQDAEEAWSQIVSQLRQKLVIKDKDSNAGDADKD
VSFVDQYLSGRFDTVLECSEQAAKDAGEMPIESSDIFFKLNCHIGKDTNHLRDGIMASLE
EDIEKHSDALDRNAVYTKKSRISRLPKYLTVHFVRFYWKRETQKKAKIMRKVTFPAELDV
VEFCTEELKRHLIPVRDKVREIRKDEQDMERARKRQKRAHQEEEQAAATFASEPLQKKKE
AESKATEPKSKDDNGPPEVFKTDAEYEAEKAESLLAAKRELFGLIDPSLANDEGANKSGL
YDLRGVITHQGASADSGHYTAYVKKQGRLVDDPKAPGGKRREEDGKWWWFNDDKVSEVGE
EKIETLAGGGESHSALILLYRAIDLPTAEEVK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctactatacctgttatcgtgaagcaccaaggcaaacggtttgaagtcgagcttgat
ccgaccgcaaatggcgagactttcaagttccagctctactccctcacaggagttgagccg
gaacgccaaaagatactcattaagggcggacaacttaaagatgagacggatctcggatct
cttggagtaaaacctggtcagacgtttatgatgatgggcacgccaggctcaggcgacccc
ggcatggttcttagaaaaccgaaagaaacacctaaattcatggaggatatgacggaagct
gaagccgctagagctgagggtgctacaccagctggtttacaaaaccttgggaatacatgt
tatttgaactcgacgctccaaacactgcgagccctccccgaactccaagaggagcttcaa
aactacaaacctttgagacagccacaatcgagcctgtttactccgagcaccgcaattgat
ctaacggcgtcacttcgagatctatataagcagatgtccgaaacccaagagggtttccct
ccgatgatgtttttgaacgcgttgaggtccgcctttcctcagtttgcgcagaaagcaagg
gatggaagaggttatgctcaacaagacgcggaggaagcctggtcccagattgtttcacaa
cttcgccaaaagttggttatcaaggacaaagattccaatgcaggagatgcagataaagac
gtatcgtttgttgatcagtatctttctggaaggttcgacacggtgcttgaatgcagcgag
caggctgcaaaagacgcgggagagatgccaatagagtcttctgatattttcttcaaacta
aactgccatattggcaaggacacgaaccaccttcgcgatggtatcatggcaagtctagag
gaggatattgaaaagcactcagacgcgctcgaccgaaacgctgtctacacgaagaaatct
cgtatttctagattgccaaaatatttgacggtgcatttcgtccgcttctactggaaacgg
gaaactcagaagaaagcaaagatcatgcgcaaggttacttttcctgctgagctggacgtt
gttgagttttgcacggaagagctgaaacggcaccttatacctgttagagataaagtacgt
gagattcggaaagacgaacaggacatggaaagagctcgcaagcgccaaaagagagctcat
caggaagaagagcaggcagcggccacatttgcgtctgagccgttgcagaaaaagaaagaa
gcagaatcgaaggcaacagaaccaaaatccaaggacgacaatggcccacccgaagtattc
aagaccgatgccgagtatgaagcagaaaaagcagagtcccttctagcagcaaaacgggaa
ctttttggtctaatcgatccatctctggctaatgatgaaggcgcaaacaagtcaggactt
tacgatttgcgaggtgtaatcacccaccagggtgctagtgcggatagtggtcattatacc
gcatatgtcaagaaacaggggaggctcgtggatgaccccaaggcacctgggggaaagaga
cgagaagaagacggtaaatggtggtggttcaacgatgacaaagtgtctgaggttggagaa
gagaagattgaaactctcgctggtgggggtgaatcgcattctgcgcttatccttctttac
cgcgcgattgacttgcccactgctgaagaagtcaaataa

DBGET integrated database retrieval system