KEGG   Uncinocarpus reesii: UREG_04582Help
Entry
UREG_04582        CDS       T01132                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ure  Uncinocarpus reesii
Pathway
ure00480  Glutathione metabolism
ure00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    UREG_04582
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UREG_04582
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UREG_04582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 8440780
NCBI-ProteinID: XP_002545065
UniProt: C4JPT9
AA seq 177 aa AA seqDB search
MTSATTFYDFETPDKKGEPFTLSSLQGKVVLVVNTASKCGFTPQFKSLEALHQKITAAHP
DKFTVLGFPCNQFGSQDPGTNDEIQTFCQTNYGVTFPVLGKVDVNGDRASPVFDWMKKEM
PGLMGLKRVKWNFEKFLISADGKVVGRWASTTKPESLEGQIVKEIEKAEKTGKTSSL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagcaacgactttctacgattttgaaacccccgacaagaaaggcgaacctttc
accctctcctccctccaaggcaaagtcgtcctcgtcgtcaacaccgcctcgaaatgcgga
ttcactccacaattcaaatccctagaagcacttcatcaaaagatcaccgctgcgcaccca
gataaattcaccgtccttggttttccttgcaaccagttcggctctcaggatcctggaacc
aacgatgaaattcagactttctgccagaccaactacggagtgacgtttcccgtcttgggc
aaagttgatgtcaatggcgatagggcatcgccggtgtttgactggatgaagaaggagatg
ccagggctgatggggctcaaacgcgtgaagtggaattttgagaagtttttgataagtgcg
gacggaaaggttgttgggagatgggctagtaccacgaagccagagtccttggagggccag
atcgtgaaggagattgaaaaggcagaaaagactggtaagacgtcgtcgttgtaa

DBGET integrated database retrieval system