KEGG   Uncinocarpus reesii: UREG_04635Help
Entry
UREG_04635        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ure  Uncinocarpus reesii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ure00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ure00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ure03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ure03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ure03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ure03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ure03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 212 aa AA seqDB search
MPPPRRRSGNSSTAGHQQTLSFGPKSRVSKPTSVPASLKNAKNTSSPSPPARSRLIAVEI
SNKAHRSSKSASPEAPDVVDPVVDPQPIAASSKSENVVREQAREQVQLPRSAEDRRAEEL
TDRDIRRYWHAEEAKRIAPRVHQEGLSVNEKILRHFDLSNQYGPCIGIARIKRWRRAHRL
DLHPPIEVLAVLLKEEAQGVAREKAYIDELLS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccacctccccgccgtcgctccggcaattcctcgaccgcaggtcaccaacaaaccctc
tccttcggccccaaatcacgagtatccaaacccacatccgtacccgcgtccctcaagaat
gcaaaaaacacctcttctccctctccccctgcccgatctcgcttgatcgccgttgaaatc
tccaacaaggcgcaccgcagttcaaagtctgcatcgccagaagcaccggatgtcgtggac
ccggtggtagatccgcaacctattgccgcgtcatccaaatccgaaaatgtcgttcgcgag
caagcgcgcgaacaggttcaattgcccaggtcagcggaagaccggagggcggaggagtta
accgatagggatatccggcggtactggcatgcggaggaagcgaagcggattgcgcctaga
gtgcatcaagaaggactgagtgtgaacgaaaagatactccggcactttgatttatcaaac
caatacgggccttgtattggtattgctaggataaaacgctggcgtcgagcccatagattg
gatctccatccacccattgaagttctcgcggtgttgctgaaagaagaagcgcaaggcgtc
gcccgggagaaggcatatatcgacgaattattgtcatga

DBGET integrated database retrieval system