KEGG   Uncinocarpus reesii: UREG_04713Help
Entry
UREG_04713        CDS       T01132                                 

Definition
pyrABCN protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
ure  Uncinocarpus reesii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ure00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ure00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2282 aa AA seqDB search
MPLFSSSSDAKSPQSPASPLRASDSLFPVAPSAGGAVAYLQNEQQPPQAAQSSISPTVIP
PASAQITEDSGRSILLELEDGTIYHGLSFGAEKSVAGELVFQTGMVGYPESITDPSYRGQ
ILVITFPLVGNYGVPSRETMDELAKDLPKHFESSQIHISGLVVASYCGEEYSHFLAESSL
GKWLKEQDVPAIYGVDTRALTKRIREKGSMLGRMLLQKSTSGKDLVHDLAETVDGEDSGR
WREHFENIEWVDPNKRNLVEEVSVKEPRLYTPPKAAILHPSGRTIRVLCVDVGMKYNQLR
CFLARGVEVLVVPWNYDFHSLGGNDYDGLFVSNGPGDPAMLASTVENLAKALKECRTPVF
GICLGHQLLSRAAGAGTIKMKFGNRGHNIPCTNMLSGRCYITSQNHGYAVDSSTLPEGWE
ELFVNANDGSNEGIRHVSKPYFSVQFHPESTPGPRDTEFLFDVFINTIKKSIESPSGLNE
PVYFPGGTIEENRLAHPKVSVKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTVL
INPNIATIQTSKGLADKVYFLPVNADFVRKVIKHERPDAIYVTFGGQTALQVGIQLKDEF
ESLGVKVLGTPIETIITTEDRELFARSMESIGEKCAKSASASTLEEALEVVKDIGFPVIV
RAAYALGGLGSGFADNTEQLRDLCAKAFAASPQVLIEKSMKGWKEIEYEVVRDAQDNCIT
VCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPF
SKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNTVTKVTCACFEPSL
DYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAIRAVDYTNLGFNAT
NALMSIKTELQTPSDQRLFAIANAMQSGYTVDDIWELTKIDKWFLRKLEGLSKFGKIISN
YTASTVPVSLVRQAKQLGFSDRQLSKFLSSNELAIRRLRVEAGIMPVVKQIDTVAAEFPA
YTNYLYLTYNGSESDISFNDKGIMVLGSGVYRIGSSVEFDWCSVRAIRTLRQQGYKTVMV
NYNPETVSTDYDEADRLYFENITLETVLDIYQLESSSGVIISMGGQTPNNIALPLHRLNV
NILGTSPEMIDAAENRYKFSRLLDRIGVDQPAWKELTSIDEATAFCAKVKYPVLVRPSYV
LSGAAMNTVYSQDDLANYLNQAVEVSREHPVVITKYIENAKEIEMDAVAKNGVMVGHFIS
EHVENAGVHSGDATLISPPQDLDPETVRRIEEATSKIGNALNVTGPFNIQFIAKDNEIKV
IECNVRASRSFPFVSKVMNVDLIEMATKAMIGRPFVEYPPVNIPKHYVGIKVPQFSFSRL
SGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPNKNILVSIGSYKEKMEMLPS
ITKLHHMGYNLFATAGTADFIREHGIPVKYLELLAGEEEDLKSEYSLTQHLANNLIDLYI
NLPSSNKFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEAIARQFELAVQPIDFQ
TSHRTVVLPGLINIAAFVPGVADVGSSDLQLVTKASISAGFSMIRVMPVGIDSFVTDARA
LKIAQNNSQKATYCDYNFSVAATSTNADQIGQITANVGSLFIPFNHLAGNINKVATVTSH
FASWPSSKPIITDAKATDLASILLLASLHNRNVHVMSVTSKDDIGLIALSKEKGLSVTCD
VAIYSLFLSTEDYPQCTCLPSKRDQEALWEHLNTIDVFSIGSLPYQLAGKEASPEVGIAD
ALPLLLTAVAEGRLTLDDVTSRLYDNPKKIFELHDQNDASVEIEVDRPYTFQTEGAWSPF
NGKTLRGSVQRVTFQGKTSCLDGAVLSDAARGTDMSDYRLAPPPSPSVKESPKSPRWDNS
VGRRLSFNTTPVPRPSRLRHMDTIALSGNELGPPLYAQPTSAPTTSPSLMELLSRSTFKQ
KHILSVNQFTRADLHLLFTVAQEMRLGVQRQGVLDILKGRVLSTLFYEPSTRTSASFDAA
MQRLGGRTVAVATEHSSTQKGESLQDTIRTLASYADAIVLRHPLESSAATAAKFSPVPII
NGGNGSMEHPTQAFLDLFTIREELGTVSGITVTFIGDLRHGRTVHSLIKLLQFYEVRVQL
VSPKALALPEDVRQHLVTSGQLVLETSELTPEAVARSDVLYCTRVQKERFEDLKEYERLK
DSFIVDNSVLKHAKSQMIVMHPLPRNAEVGEEVDFDQRATYFRQMRYGLYCRMALLALVM
AP
NT seq 6849 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcttcagctcttcctccgacgcgaaatctccccaatctcctgccagccctctg
agagcttcggactcgctcttccccgttgccccctccgccggcggtgccgttgcatacctg
cagaatgagcagcagcccccccaggccgcacagtcctccatcagtccgactgtgatccct
ccggcctccgcacagatcaccgaagactccggcagatcaattcttctcgagctcgaagat
gggaccatctaccatggactcagctttggtgcggagaagagcgttgccggcgagctggtc
ttccagaccggcatggtggggtaccctgaatcgataacagatccttcgtatcgcgggcag
atcctggtcattacgttccctctcgtgggcaattacggtgtcccgtcccgtgagaccatg
gacgaattggcaaaggatctccccaagcacttcgagtccagccaaattcacatctccggg
ttggtcgtcgccagctactgcggagaggagtactcgcacttcttggcagagagctccttg
ggcaaatggctgaaagaacaggatgttcctgcaatctacggcgtcgatacccgggctcta
acaaagagaatccgcgaaaagggtagtatgctcggccgtatgctgcttcaaaagtccaca
agcggaaaagacctggttcacgatctcgcggagaccgtcgatggtgaagattcggggaga
tggcgcgagcattttgaaaatatcgaatgggtagatcccaacaagagaaatctcgtcgaa
gaggtctcggtcaaggagcctcgactttatacaccgccaaaggctgccattctccacccc
tcaggtcgtaccatccgtgttttatgtgtcgacgttggcatgaaatacaatcaacttaga
tgtttcctcgctcgtggcgttgaagttcttgttgtaccctggaactacgactttcattcc
ctgggcggcaatgactatgacggcctcttcgtgtccaacggccctggtgacccagcgatg
ctcgcctccaccgttgaaaatcttgcaaaggccctgaaggaatgccgaaccccagtcttc
ggtatctgccttggtcaccagctcctttctcgtgccgccggcgccgggactatcaagatg
aagtttggaaaccgtggtcacaacatcccttgcaccaacatgctgtcaggacgttgttat
attacctcccagaaccatggttatgccgtggattcctcaaccctacccgaaggctgggag
gaactgtttgtcaatgccaacgacggaagcaacgaaggcattagacacgtttccaagcca
tatttcagtgttcaattccaccctgaaagtacaccgggccctcgggacaccgaatttctc
tttgatgtcttcatcaatacaattaagaagagcatcgagtctccttctggattgaacgag
cccgtctacttccctggtggcacaattgaagaaaaccgcctcgcccaccctaaggtctca
gtcaagaaggtcctcatcttgggcagtggtggtcttagcatcggccaggccggagaattt
gactactcgggtagtcaagcgatcaaggccctcaaagaggaaggaatttacaccgtccta
atcaacccgaacatcgcaacaattcaaacatccaagggacttgcagacaaagtctacttc
ctcccggtcaacgctgatttcgtgcgcaaggtcatcaaacacgaacgtcctgatgctatc
tatgtcacgttcggtggtcaaaccgccttgcaggtcggcattcagcttaaagacgagttt
gaaagccttggggtcaaggttctaggtactcctatcgaaaccatcatcaccaccgaggac
cgtgaactgtttgctcgaagcatggaatctattggagaaaagtgcgccaagtctgcctcg
gcttctactctcgaagaagccctcgaagttgtcaaggatatcggcttccccgtcattgtc
cgggctgcatacgcgctcggtggtcttggaagcggtttcgcagacaatactgagcaactg
cgggatctttgcgccaaggcgttcgccgctagccctcaggtcctgattgaaaagagtatg
aagggatggaaggaaatcgagtatgaagttgttcgtgatgcacaggacaactgcatcaca
gtctgcaacatggagaactttgatcccctcggtatccacactggtgactcgatcgtcgtt
gctccgtcacagaccctgtcagatgaagactataatatgctccgaacaacagcagtcaat
gtcattaggcatttgggtgtcgtgggcgaatgcaatatccaatatgccctaaatccgttt
tcaaaggaatactgcattatcgaagtgaatgcacggttgtccaggtcttctgctcttgct
tccaaggcgactggctacccattggcattcattgctgcgaagctgggtctcggtatcccg
ttgaacgaaatatccaacaccgtcactaaggtgacatgcgcctgcttcgaaccatctctt
gattatgttgtggtcaagatccctcgctgggatttgaagaaattcactcgtgtctcgacc
cagcttggctcttcaatgaagagtgtcggtgaggtcatgagtattggtagaacctttgaa
gaagccatacaaaaggccattcgtgccgtcgattacactaacttgggtttcaacgccacc
aatgcattgatgtcgatcaaaactgagcttcagactccttctgaccagcgactctttgct
atcgcgaacgctatgcagtccggttatactgtcgatgatatttgggagctgaccaagatt
gataaatggttcttgcgcaagctcgagggccttagcaaatttgggaaaataatcagcaat
tatactgcttccaccgtcccagtttctcttgttcgacaggccaagcagctcggtttctcc
gaccgccagctatctaaatttttgagttcaaatgaattagccatccggagactgagggtc
gaggctggcatcatgcctgttgtgaaacagattgacactgttgctgctgagtttccggct
tacaccaactacctttatctaacctacaacggttcagagagcgatatctcattcaacgat
aaaggtatcatggttcttggatctggtgtttaccgaattgggtcttccgttgaattcgac
tggtgctctgttcgagctatccgaacactcagacagcaaggatacaagacggtcatggtg
aactacaatccggaaaccgtcagtactgattatgatgaagctgatcgactgtattttgaa
aacattactttggagactgtcctcgatatctaccagctggagtcttcaagtggcgttatt
atctctatgggtggccagacaccgaacaatatcgccttgccgttgcatcgcctgaatgtc
aacattttgggtacctcgccagagatgatcgatgccgcagagaatcgttacaagttctcc
cgcttgcttgaccgcattggtgtcgaccagcctgcatggaaggagcttactagcattgac
gaggcgacggcattctgtgccaaggtcaaatatccagtgcttgtccgtccttcttatgtc
ctttccggcgctgcgatgaataccgtctactctcaagatgatttagccaattatctcaat
caagccgttgaggtctcgagagaacacccggttgtcatcacaaagtacattgaaaatgcc
aaggagatcgaaatggatgccgttgcgaagaacggtgtgatggttggccactttatctct
gagcatgttgagaatgctggtgttcattctggtgatgcaactctcatctcacctccccag
gatttggatccagagactgtccgccgaatcgaggaggcaacgagcaagattggaaacgct
ctcaatgtgaccggtcctttcaacatccagttcatcgccaaggacaacgagattaaggtc
atcgaatgcaacgttcgagcttcgcgatctttcccatttgtttccaaggtcatgaacgtc
gatttgattgaaatggccacgaaggcaatgatcgggcgaccattcgtcgaataccctccc
gttaatatcccaaaacactatgttggcattaaagttcctcagttctctttctctcgactg
tctggtgccgatccagtccttggtgtcgaaatggcttccaccggtgaagtcgcttgtttc
ggtcgcgacaggtatgaggcatatctcaaagctctcatctcaactggcttcaagcttccg
aataagaacattcttgtttccattggatcctacaaggagaaaatggaaatgcttccttcg
attaccaagcttcaccacatgggttataatctcttcgcaacagctggtactgcagacttt
atccgcgagcacggcattccggtgaagtatctcgaacttctagcgggcgaggaagaagat
ttgaaatcggaatactcgcttacccaacatcttgccaacaacttgattgatctttacatc
aaccttccatccagcaacaagtttagaaggccggccaactacatgagtaaggggtatcgg
actcgtcgtatggccgtcgattatcagacaccccttgtgaccaacgtgaagaatgcaaag
attttgattgaggcaattgctcgccagtttgagttggctgtgcagcctatcgatttccag
actagccatcgcactgtcgttctccctggattgatcaatattgctgcattcgtacccggt
gttgcagatgttggctcatcggatctccagttggtaaccaaggcatcaatctctgctggc
ttttcgatgatccgagttatgccggtcggaattgatagcttcgttactgacgcccgagct
ctgaagattgcgcaaaacaactcccagaaagccacgtattgcgattataatttttccgtt
gccgccacatcgaccaatgcggatcaaattggacagatcaccgctaatgttggctctttg
ttcattccgtttaatcatttggccggaaatatcaacaaagtggctactgtcacatctcat
tttgcttcgtggccatcgagtaaaccgatcatcacggacgcaaaggcgactgatctagcg
tccatcctgcttcttgccagccttcacaacaggaatgtccatgttatgagcgttacttca
aaggacgatattggcttgattgcgttgagcaaggagaagggattgagtgtcacttgcgat
gtcgcgatttactcccttttcctttccaccgaagactacccgcaatgcacttgtctgccg
tcgaagagagatcaggaggctctctgggagcatctgaataccatcgacgttttctccatt
ggaagcttgccataccagcttgcgggcaaggaggcaagtccagaagttggcattgccgat
gctctcccactactgttgaccgctgttgccgaagggcgcctgactcttgacgacgttacc
tctcgactttacgacaacccgaagaagatatttgagcttcacgatcagaatgatgcctcc
gtcgagattgaggtcgaccgaccctataccttccagactgaaggcgcctggtctccgttt
aacggcaaaactctccgcggatcagttcagcgcgtcaccttccaaggaaagacgtcttgc
cttgacggggctgtgctcagtgatgccgctcgcggtacagacatgtctgactatcgactt
gcgccccctccgtcgccctctgtcaaggagtctcccaagtctcctcgatgggacaactcg
gttgggcgacgcctttccttcaacacgacacccgttccacgtccctcacgcttgaggcat
atggataccatcgccctctcaggcaacgaattgggtccgcctttgtatgcccaaccaaca
agcgcgccgacgacatccccatcgctgatggagctgctctcgcgttcaaccttcaagcag
aagcacatcctatcagtgaatcaatttactcgagctgaccttcaccttttgtttaccgtt
gcgcaagaaatgcgacttggtgttcaacgtcaaggtgtcctcgatattttgaagggccgg
gtcctatcaacgctgttctacgaaccctctacccgcacttctgcctcgttcgatgctgcc
atgcaacgccttggtggccgcacggttgccgttgctactgagcattcatcgacccagaag
ggcgagtcgcttcaggatacgattcgcacgcttgcttcttacgctgatgcgatcgtcctt
cgccatccacttgagagcagcgctgccaccgcagccaaattctctccagtccctattatc
aatggtggcaatggaagcatggaacatcctactcaggccttcctcgacctctttactatc
cgtgaggaacttggaacggtcagcggcatcacggttacttttatcggcgatcttcgccat
ggccgcaccgtacattcgttgatcaagctcctccagttctacgaggtccgcgtgcagctg
gtatctcccaaggctcttgctctgccagaagacgttcgtcagcacctcgtcacgtctggc
cagctagtcctcgaaaccagcgagctgactcccgaggctgttgcccgctctgatgtcctc
tattgcactcgggtgcagaaggagcgctttgaggatctgaaggagtacgagcggctcaag
gacagtttcattgtcgacaactcggtgctcaaacatgcaaagagccagatgattgtgatg
catccgctgcccaggaacgcggaggtcggtgaagaggtggactttgatcagcgggctacg
tatttcagacagatgagatacggcctctactgtcgcatggcgttgttggctttggtgatg
gcaccctga

DBGET integrated database retrieval system