KEGG   Uncinocarpus reesii: UREG_04750Help
Entry
UREG_04750        CDS       T01132                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ure  Uncinocarpus reesii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ure00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    UREG_04750
Exosome [BR:ure04147]
 Exosomal proteins
  Proteins found in most exosomes
   UREG_04750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1741 aa AA seqDB search
MAPLPIKFTELLQLTNLDIVVCIASPFSLYNRLGICDLGLGHAASFKCVAKADMVSALAG
IHWIQFMCKCPLYASAGRASGSLSRVRSIQTLESDKFVCIRQKLSENDKTQVIIIDLKNN
NEVVRRPINADNAIMHWSKNIIALKAQGRTVQVFDLQAKEKLKSAVLTEDVVYWKWFSET
SLGLVTEAAIYHWNVFDPSQHAPLKMFDRISNLNGCQIISYKVNEDQKWMAVVGISQQQG
RIVGTMQLHSVERGISQHIEGHAATFASISVEGSPLPHKLFAFAVRTQTGAKLQIAEIDH
QEPNPKFPKKAVEIYFPPEATNDFPVAMQVSKKYDIVYLVTKFGFIHLYDLESGTCIFMN
RISSETIFVTTPDSESTGLVGVNRKGQVLSVSVDESTIIPYLLDNPANTSLAVKLAAKAG
LPGADNLLQRQFETLLTQQNYMEAAKVAANSPRGFLRTPETINRLKSAPQSAQGMSVILQ
YFGMLLDKGTLNKHESIELVRPVMQQSRKHLLEKWLGEDKLECSEELGDIVRPYDIGLAL
GIYLKANIPHKVVAGFAETGQFDKILAYSRQVGFQPDYVQLLQHIVRVNPEKCAEFAGQL
VSEESGAAVDLDRVVDVFISQNMIQQATAFLLDALKDNKPEHGHLQTRLLEMNLVNAPQV
ADAILGNEMFTHYDKARISQLCENAGLYQRALENTEDPAVIMRNIVRTDKLNPDWLTNYF
GRLSVEQSLDAMNEMLKVNLRQNLQAVVQLATKFSDLLGANNLISLLEKYRTAEGLYYYL
GSIVNLSEDPDVHFKYIEAATKMGQMTEVERICRESNYYNAEKVKNFLKEARLTEQLPLI
IVCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRTPAVVGGLLDVDCDEGIIKNLLST
VDASSIPIDELVSEVESRNRLKILLPFLENTLSTGNQQQAVYNALAKIYIDSNNNPEKFL
KENDLYDTLVVGKYCEKRDPNLAYISYRKGQNDLELINITNENSMYRAQARYLLERADSE
IWAFVLNGNNIHRRSLVDQVIATAVPESAEPDKVSVAVKAFLEADLPTELIELLEKIILE
PSPFSDNGSLQNLLMLTAAKADKSRLMDYIHKLTEFNAEEIANMCLSVGLYEEAFEIYKK
VDNHISATNVLVDYIVSIDRAQEYAERVELPEVWSKVAKAQLDGLRVSDAIASYIRAGDP
SNYNEVIETATHAGKDEDLVEYLKMARKTLREPAVDTALALSYARLNQLPELEDFLRAVN
VADVEASGDKAYEEGYHEAAKIFFSSISNWAKLATTLVHLEDYQAAVECARKGNNVKVWK
QVNEACVAKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIALLEAGLGLERAHM
GMFTELGIALSKYHPDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLYCHYDEWDNA
ALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNR
VVRMFEKSDNIPLIKPFLLNVQTQNKKAVNNAINDLLIEEEDYKTLRDSVENYDNYDPVE
LAQRLEKHELVFFRQIAASIYRKNKRWEKSISLSKQDKLFKDAIETAAISGKTEVVEELL
RYFVDIGSRECYVGMLYACYELIRPDVVLEVSWRHGLHDFTMPYLINVLSQQVRTIETLK
QDNEERKAREAAQQKEEDNTPVLGGSRLMLTQGPGSPAGHAMPFGGATNGITPQATGFRP
F
NT seq 5226 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcttccaatcaagtttacggagttgctacagttgacgaatcttgacatcgtg
gtatgtatcgcatcccccttctcactctacaatcggctcgggatttgcgacctcggattg
ggacatgcggcctctttcaaatgtgtggccaaagctgacatggtatctgccttagccggc
atccattggattcaattcatgtgtaagtgtcctctctacgcctctgcaggacgagcatct
ggctcactgtcgcgtgtgagatctattcagacccttgaatccgataaattcgtctgcatt
cgccagaaactatcggaaaatgacaaaacacaagtcatcatcatcgacctaaaaaataac
aatgaagtcgtccgccgccccatcaacgccgacaatgccatcatgcattggagcaagaat
atcattgctctaaaagctcagggtaggaccgtccaggtattcgatctccaggccaaggag
aaactgaagtcagctgtcctcacggaggatgtcgtgtactggaaatggttcagcgagaca
agcttaggcttagtgacggaggccgcgatttatcattggaatgtgttcgatccgtcacaa
cacgccccattgaagatgtttgatcgcatctcaaacctcaacggatgccaaatcattagt
tacaaagtcaatgaagaccagaaatggatggccgttgtcggtatcagccagcagcaggga
cgcatcgtaggaacaatgcaacttcactctgtcgaacggggcatttcgcagcacatcgaa
ggccacgccgccaccttcgcttccatctccgtcgaaggctcgcctttgccccataaactt
tttgcttttgcggtccgcacccaaaccggagcaaaattgcaaattgcggagattgaccac
caggagccgaaccccaagttccccaagaaagccgtcgagatttacttcccaccagaagct
acaaacgatttcccagttgcgatgcaagtttccaaaaaatacgacatcgtatacctggtt
acgaaattcggtttcatccatctttacgacctagagtcaggcacctgcattttcatgaac
cgtatctctagcgagacgatttttgttactaccccggattccgagtccaccggtcttgtt
ggtgtcaatcgcaaaggccaagttctctccgtcagcgtcgacgaaagcaccatcattcct
tatcttctcgataacccagctaacacatctcttgctgttaaactggctgccaaggccggc
ctgccaggcgcagataacctgctccagagacagtttgaaacgctccttacacagcaaaat
tatatggaggctgccaaagttgccgcaaactcgccacgtgggtttctccggaccccggaa
actattaaccgtctaaagagtgcacctcagagtgctcaaggaatgtctgtcattcttcag
tactttgggatgctgttggacaagggtactttaaacaaacatgaaagcattgaattggtt
cgaccggtcatgcagcagagtcgaaagcatttgcttgaaaaatggttgggcgaggacaag
cttgaatgctctgaggagttgggcgatattgtacggccatacgatatcggacttgctttg
gggatttatttgaaggcaaatattccacacaaggttgttgctggctttgcggaaaccggg
caattcgataaaatcctggcgtactcaaggcaggtcgggttccaacccgactacgtccag
cttcttcaacatattgtccgcgttaatcctgaaaagtgtgctgaatttgccgggcagcta
gtcagtgaggaaagcggagcggccgtggatctcgaccgtgtagttgatgttttcatttcc
cagaacatgatccagcaggcgacagcatttttactcgatgctctcaaagataacaaaccg
gaacatggacaccttcaaacccgccttttggaaatgaaccttgtcaatgcgccccaagtt
gccgatgctattcttggaaacgagatgttcacccattacgacaaggctagaatctcacaa
ctctgcgagaacgccggattgtaccagcgtgccttggagaatactgaagatccggcggtg
atcatgcgcaacattgtgcggaccgacaaattgaatcctgactggttgacaaactatttt
gggcgattgtccgttgaacagtcattggatgctatgaacgaaatgttgaaggtgaacttg
cggcaaaatcttcaagcggttgtccaactcgctactaaattctcggacttgctaggcgca
aataacctgatttctctgctcgagaaatatcgaactgcagagggcctgtactattacctg
ggcagtatcgtgaatttgagtgaagatcccgacgtccattttaaatatatcgaggcggcg
actaagatgggacaaatgacggaagtggagcggatttgccgtgaaagcaactattataat
gcggagaaagtcaagaatttcctcaaggaggctcgccttactgagcagcttcctcttatt
attgtctgcgaccggttcaactttattcacgatttggtactttacttgtatcagaatcaa
cagtacaagtctatcgaggtgtacgttcagcgagtgaacccatcacgaactccggcggtt
gttggaggactccttgatgttgattgcgacgagggtattatcaaaaacctgctctccact
gtggatgcctcgtccatacccatcgacgagctcgtatctgaagttgaaagtcgaaaccgc
ttaaagatccttctcccgtttcttgagaacaccctttctactggtaaccaacaacaggcg
gtctacaatgctctcgcaaaaatttacattgacagtaataacaatcctgagaaattcctg
aaagagaacgatctctatgatacattggtggtcggtaaatactgcgagaaacgcgaccct
aatttggcttacatttcgtaccgaaaaggccagaatgaccttgagctgatcaacatcacc
aacgagaactcaatgtaccgcgcccaagcacgatatcttctcgagcgcgccgattccgaa
atctgggcttttgttctcaacggaaacaacatccatcgtcgctctcttgttgaccaagtc
attgcgaccgccgttccagagtccgctgagcctgataaggtatctgttgccgtcaaagcc
ttcctcgaagcggacctccctacggaattaattgagcttctagagaagataatcttagag
ccatctccgttcagcgataatggcagtctccagaatctcttgatgctcacggcagccaag
gcggataagagccggttgatggactatatccacaaactcacggagttcaatgcggaggag
attgccaacatgtgcttatcggttggcttgtacgaagaagcctttgagatttacaagaaa
gtcgacaaccacatctcggcgacaaacgtccttgtggattatattgtcagtattgatcga
gcacaagagtatgcggagcgagtggaactccccgaggtgtggagtaaagttgccaaagct
cagcttgacgggctccgtgtttccgatgcgatcgcttcgtatatccgtgctggcgacccg
tctaactataacgaagtcattgaaaccgcgacccatgctggtaaagacgaggatcttgtt
gagtacttgaaaatggccaggaagacgctccgagagccggctgtcgacactgcactagcg
ctttcgtatgccagattaaatcaactccctgagcttgaagacttcctccgtgccgttaac
gtcgccgatgttgaagcctctggtgacaaggcctatgaagagggataccatgaagcggcc
aaaatctttttctccagcatatcaaactgggcgaaactggcaaccactttggtccacctt
gaggactaccaggcggcagtcgagtgtgccaggaaaggaaataatgtcaaggtgtggaag
caggtgaacgaggcgtgtgttgctaaaaaggagtttcgactggctcaaatttgcggactc
aatcttattgtccacgccgaggagctccaggatctggtccggcagtatgagcgcaatggg
tattttgacgaactcatcgcattactcgaggccggtctcggtttagaacgggcacacatg
ggcatgttcactgagcttggcattgccttgtcgaagtaccatccggatcgggtcatggag
catctgaagctcttctggactcgcatcaacatccccaagatgatccgcgcatgcgaggaa
gcgaacctgtggcccgagcttgtgttcctgtactgccattacgacgaatgggacaatgca
gcgttggcgatgatggagcgagcggctgatgcatgggaacaccattcgttcaaggacata
atcgtcaaggtggcaaatctggagatctattatcgagcgttgaacttttatctccaggag
caacctctactgttgacggacttgctccaggtgcttactccacgaatcgacgtcaaccgg
gttgtccgcatgttcgagaagtctgacaatatcccgctgatcaagccgttcttgttgaac
gtgcagacccagaataagaaggcggtgaacaatgcgatcaatgacctgttaattgaggag
gaggactacaagacgcttcgtgattcggttgagaactacgacaactacgatccggttgag
cttgcgcagcggctggagaagcacgagttggtgttcttccggcagatagcggccagcatt
taccgcaagaacaagcggtgggagaagtcgatctcgctgtcgaagcaggataaactgttc
aaggacgccatcgagacggcggcgatttcgggcaagacggaggtggtggaggagctgctg
cgctactttgtggacattgggagccgcgagtgctacgtggggatgctgtacgcgtgctac
gagctgatccggccggacgtggtgctggaggtatcgtggcggcacgggctgcacgacttc
acgatgccgtacctgatcaacgtgctgagccagcaggtgcgcacgatcgagacgctgaag
caggacaacgaggagcgcaaggcgagggaggcggcacagcagaaggaagaggacaacacg
ccggtgctaggggggtcgcgactgatgctaacgcagggccccggcagcccggcagggcat
gccatgccgtttggcggagcgacgaacgggatcacgccgcaggcgactgggttccggccc
ttttaa

DBGET integrated database retrieval system